RetrogeneDB ID:
retro_mputfur_1151
Organism:
Location:
GL897026.1:5421147-5421412 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.43 %
Coverage:
76.72 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
NDUFA5
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 [Source:HGNC Symbol;Acc:7688]

Genomic region (view in browser)





>retro_mputfur_1151
TACACAAAGATTCTTGATAATCTTGAGCAAATTCTTAAAAATTCAGCATATAGAAAGTAT
ACAGAACAGATTACAAATGAAAAGCTAATTATGGTTAAAGCAGAACAAGATGCTAAGAAA
TTAGAAGACTAACTTCAGGGTGGTCACTAGAATAGGTGATTCTTCAGGCTAAATATAACT
AGGTCTGGCAATAAAAAATGATACAGAATAAACCATGGAACTCTTAGCAGAAGACCCTCC
TGCCAACCAATGGAAAGGGCCAATA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YTKILDVLEQIPKNAAYRKYTEQITNEKLSMVKAEPDVKKLEDQLQCG-QLEEVILQAENELSLARKMLQWKPW-EPLVEEPPANQWKWPI
YTKILD.LEQI.KN.AYRKYTEQITNEKL.MVKAE.D.KKLED.LQ.G..LE.VILQA........KM.Q.KPW.E.L.E.PPANQWK.PI
Retrocopy
YTKILDNLEQILKNSAYRKYTEQITNEKLIMVKAEQDAKKLED*LQGG/SLE*VILQAKYN*VWQ*KMIQNKPW/ELLAEDPPANQWKGPI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide