RetrogeneDB ID:
retro_mputfur_1152
Organism:
Location:
GL897027.1:796257-796820 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.42 %
Coverage:
56.76 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1152
ACTGGCAAAGTGGATATTGTCGCCATCAACAACCCTTTCATTGATCTCAACTACATAGTC
TATATGTTCCAGTATGATTCTACCCACGGTAAATTCCACGGCACAGTCAAGGCTGAGAAC
GGGAAGCTTGTCATCAATGGGAAGTCCATCTCCATCTTCCAGGAGCGAGATCCCGCCAGC
ATCAAATGGGGCAATGCTGGTGCTGAGTATGTTGTGGAGTCCACTAGGGTCTTCACCATG
GAGAAGGTGGGGCTCACTTGAAGGGCGGGGCCAAGAGGGTCATCATCTCCACTCCTTCTG
CTGACGCCCCCATGTTTGTGATGGGTGTGAACCATGAGAAGCATGACAACTCCCTCAAGA
TTGTCAGCAATGGCTCCTGTACCACCAACTGCTTGGCTCATCTCGTCAAGATCATCCATG
ACAACTTCGGCATCATGGAGGGACTCATGAGCACCGTCCATGCCATCACTGCCACCCAGA
AGACTGTGGACGGCCCCTCTGGGAAGCTGTGGCGTGACAGCTAAGGGGATGCCCAGAATA
TCATCCCTGCTTCCATTGGTGCG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAG-AHLKGGAKRVIISA
.GKVDIVAIN.PFIDLNY.VYMFQYDSTHGKF.GTVKAENGKLVINGKSISIFQERDPA.IKWG.AGAEYVVEST.VFT.MEK.G.AHLKGGAKRVIIS.
Retrocopy
TGKVDIVAINNPFIDLNYIVYMFQYDSTHGKFHGTVKAENGKLVINGKSISIFQERDPASIKWGNAGAEYVVESTRVFT-MEKVG/AHLKGGAKRVIIST


Parental protein
PSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGA
PSADAPMFVMGVNHEK.DNSLKIVSN.SCTTNCLA.L.K.IHDNFGI.EGLM.TVHAITATQKTVDGPSGKLWRD..G.AQNIIPAS.GA
Retrocopy
PSADAPMFVMGVNHEKHDNSLKIVSNGSCTTNCLAHLVKIIHDNFGIMEGLMSTVHAITATQKTVDGPSGKLWRDS*GDAQNIIPASIGA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide