RetrogeneDB ID:
retro_mputfur_1153
Organism:
Location:
GL897028.1:6055419-6055823 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.48 %
Coverage:
61.04 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
SNRPB
Parental gene aliases:
No gene alias available
Parental gene description:
small nuclear ribonucleoprotein polypeptides B and B1 [Source:HGNC Symbol;Acc:11153]

Genomic region (view in browser)





>retro_mputfur_1153
CCACCCCCACAAAGATACTGGCATTGCTCAAGTACCACTTGTTGGAGCTGCAGGAGGCCC
TGGGGTTGGCGGAGGAGTGCCAGCTAGCTGTCCAACTCCCCAAGTTCCTGCTGGATTAGC
AGGTCTTGTCCAAGGAGTTGGGGAGCCATCCCAACAGGTAATGACTCCAGAGGGAAAAGC
CACTGTAGCAGCTGCTACAACTCAGTAGCCACTATTAGGAGGTACCCCACTCACTCCTGT
GGGTTGGGTAACACCACCTCCAGGCATTATGGCTCCTCCACCTGGTATGAGATCACTCAC
AGGCCCACCAACTGGGCTTTTCCCTGCTTGAAGGACTCCAGTAGGCATGTCCTCCCATCC
CAGGAATGAGACCCCTTTCTCCAGGTATTAGAGGTCCACCTCCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PPP-KDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGA
PPP.KDTGIA.VPL.GAAGGPG.....G.G.PA..P.PQ.PAGLAG.V.GVG.PSQQVMTP.G..TVAAA.........G.P...P.G...PPP..G..A
Retrocopy
PPP\KDTGIAQVPLVGAAGGPGV----GGGVPASCPTPQVPAGLAGLVQGVGEPSQQVMTPEGKATVAAATTQ*PL-LGGTPLT-PVGWVTPPP--GIMA


Parental protein
PPPGM---MGPPPGMRPPMGPPMGI-PPGRGTPMGMPPPGMRPPPP
PPPGM....GPP.G..P....P.G..PP..G..M....PG.R.PPP
Retrocopy
PPPGMRSLTGPPTGLFPA*RTPVGM\PPIPG--MRPLSPGIRGPPP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide