RetrogeneDB ID:
retro_mputfur_1154
Organism:
Location:
GL897028.1:193408-193914 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.29 %
Coverage:
51.52 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_mputfur_1154
GGTCATCCAGTCAATTATCAGCAGAATTACCAGAATAGTGAGAGTGAGGAAAAGAAAGAG
GATCAGAAAGTGTTCCCAAAGGCCAAGCCCCATAGTGCATGCCCTACCACAGGCAGCAGT
TCCCACCTTAACTACATGTGGAGACCCTATGGGTGTTCACCTCCTGTATTCTGACCCTCC
TATGCAGAGAGAAGAGATGGAAGGTGCAGACAACCAGGGTGGAGGAGAACAGGTAGACCA
GTAAGACATAATATGTATCAGGGTTATAGACCATGATTCTGCTAGGACCTTCTTGCTAAA
GACAGCCTAGAGAGAATGGCAATGAAGAAGATGAAGAAAATCAAGGAGATGAGACCCAAG
GTCAGCAGCCACCTCAGCGTCAGTAGTGCTACAACAATAACCAACACAGACACCCAGAAA
ACCTTAAACCACAAGGTGGCAAAGAGACTAAAGGAGATAATCCAGCAGCTGAGAATTCAT
CAGCTGCAAGCCTGAGCAGGCCAGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GPPHNYQQNYQNSESGEKNE-GSESAPEGQAQQRRPYRRRRFPP-YYMRRPYGRRPQ-YSNPPVQGEVMEGADNQGAGEQ-GRPVRQNMYRGYRPRF-RR
G.P.NYQQNYQNSES.EK.E.GSES.P.GQA....PY.R..FPP..YM.RPYG..P..YS.PP.Q.E.MEGADNQG.GEQ.GRPVR.NMY.GYRP.F...
Retrocopy
GHPVNYQQNYQNSESEEKKE/GSESVPKGQAP*CMPYHRQQFPP\NYMWRPYGCSPP\YSDPPMQREEMEGADNQGGGEQ/GRPVRHNMYQGYRP*F/LL


Parental protein
GPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGG
GP...RQPRE.GNEED.ENQGDETQGQQPPQR....N.N...R.PEN.KPQ.GKETK...P.AENSSA......G
Retrocopy
GPSC*RQPRENGNEEDEENQGDETQGQQPPQRQ*CYN-NNQHRHPENLKPQGGKETKGDNPAAENSSAASLSRPG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide