RetrogeneDB ID:
retro_mputfur_1155
Organism:
Location:
GL897028.1:3238483-3239379 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.72 %
Coverage:
94.97 %
Frameshifts:
6
Stop codons:
7


Parental gene:
Parental gene symbol:
TYMS
Parental gene aliases:
No gene alias available
Parental gene description:
thymidylate synthetase [Source:HGNC Symbol;Acc:12441]

Genomic region (view in browser)





>retro_mputfur_1155
TCCCCACCCGCCACATAGAGGTGTGGTATGGAGCCCTTGGCCTCCACCCCATGGGAAGCT
GCAGTACCTGGGGCAGATCCAGCACATCCTTCACTGAAGGTTCCAGAAGGATGAGAGCAC
TGGCACCAGCATGCTGGGGTGTTTGGCATGCAGTTGCACTACAGCCTGAGAGATGAATTT
CCTTTGCTGATAACAACACATATATTCTGAAAGAGTGTTTTGGAGGAGTTACAGTGTTTT
ATCAAGGGCTTTACAAATGCTAAGGAACTGTCTCCTAAGGGAGTGAAAATCTGGGAAGTC
AATGCCTCCTAAGACTTCTTGGACAACCTGGGATTTTCCAATAGAGAAAAGGGGATTTAG
GTTCAATTTATGGTTCTCAGTGGAGAAGGCATTTTGGGGCAGAATACAAAGATGAGGATT
CAGATTATTCAAGTTAAGGAGTACACTAACTGCAAAAGATGCTTCGCACAGTTGAAATCA
AACTCAAGGACAGAAGAATTATCTTGTGTGGTTGGAATCCCAAAGCACTTCCTTTTATGG
CCCTATCTCCCTGCCATACCTTTCCCAGATCTCCATGGTGAGCGGTGAGCTGTCCTGCCA
GCTGTACTGGAGGGAAGGAGACATGGTTTTGGCTGTGTCCTTCAACTTGGCCCTCCACAC
CTGGCCCACTATATGATCACACACATCAAAGGCCTGAAAGCAGGTGACTTCATACATATT
TTGAAGATACACATATTTGCCTGAATTATGTTGAACCTCTAAAAGTGCAGCTTCAGTGAG
AACCAGCACCTTTCCTAAAGCTCAAAATCCTTCAAAAAGGTGAGACCATCCATGACTTCA
AGGCTGAAGACTTTCTTCACAGTATTCACCCAACTATTAAAATGAAAATGGATATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SPPAAQKPAAEPQ-PAPHGELQYLGQIEHILRCGVRKDDRTGTGTLS-VFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIW
SPPA......EP..P.PHG.LQYLGQI.HIL.....KD..TGT..L..VFGMQ..YSLRDEFPLL.T...F.K.VLEEL..FIKG.TNAKELS.KGVKIW
Retrocopy
SPPAT*RCGMEPL\PPPHGKLQYLGQIQHILH*RFQKDESTGTSMLG/VFGMQLHYSLRDEFPLLITTHIF*KSVLEELQCFIKGFTNAKELSPKGVKIW


Parental protein
DANGSRDFLDSLGFSNRE-EGDLGPVYGFQW-RHFGAEYIDKDSDYSGQGVDQLQKVIDTIKTNPDDRRIILCGWNPKDLPLMALPPCHA-LCQFYVVNG
..N.S.DFLD.LGFSNRE..GDLG..YG.QW.RHFGAEY.D.DSDYS..GV..LQK...T......DRRIILCGWNPK.LP.MAL.PCH..L.Q...V.G
Retrocopy
EVNAS*DFLDNLGFSNRE/KGDLGSIYGSQWRRHFGAEYKDEDSDYSS*GVH*LQKMLRTVEIKLKDRRIILCGWNPKALPFMALSPCHT/LSQISMVSG


Parental protein
ELSCQLYQRSGDMGLGVPFNIASYA-LLTYMIAHITGLKPGDFVHTL-GDAHIYLNHIEPLKMQLQREPRPFPKLKILRKVETIDDFKAEDFQIEGYSPH
ELSCQLY.R.GDM.L.V.FN.A....L..YMI.HI.GLK.GDF.H.L..D.HI.LN..EPLK.QLQ.EP.PF.KLKIL.K.ETI.DFKAEDF.....S.H
Retrocopy
ELSCQLYWREGDMVLAVSFNLALHT/LAHYMITHIKGLKAGDFIHIL/EDTHICLNYVEPLKVQLQ*EPAPFLKLKILQKGETIHDFKAEDFL---HSIH


Parental protein
PTIKMEMAV
PTIKM.M..
Retrocopy
PTIKMKMDI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide