RetrogeneDB ID:
retro_mputfur_1156
Organism:
Location:
GL897028.1:3240124-3240678 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.27 %
Coverage:
89.9 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL7
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L7 [Source:HGNC Symbol;Acc:10363]

Genomic region (view in browser)





>retro_mputfur_1156
AGGAAGGTGTACAGAACTGAGATTCAAATGGTTAGGATAGCAAGAAAAGCTGGCAACTTC
TATGTACCTATGGAACCCAGACTGGATTGGTCATCAGAATAAGGTATCAATGGTGTCAGC
CCAAGTGTTTCAAAGGTATTACAGCTTCTTCGGCTTTGCCAAAAATTCCATAGCACTTTG
TTAAGCTCAATAAGGCTTCAGTTAACATGCTAAGGATTATGGTATATATAGCATGGGGGG
TACCCAAACCTGAAACCAGTGAATAAATTGATCTATAAGGGTGGTTATGGCAAAATCAAC
TAGAAGCAAACTACCTGAAAGACAACACACTGATCGCTTGATCTCTTGGTAAATATGGCA
GCATCTGCAGGGAGGTGGCTCTGATTCAGGTCTATACTGTTGGAAAACATTTCAAAGAGG
CAAACAACTTCTGAGGACCCTTCAAATTATCTTTTCCAAGATGGGGAAGGAAGATGACGA
CCTCCCATTTTGTGCAAGGTGGAAATGCTGGCAAGGTAGAAGTTCAGATCAATAGGCTTA
TCAGAAGGATGAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RQMYRTEIRMARMARKAGNFYVPAEPKL-AFVIRIRGINGVSPK-VRKVLQLLRLRQIFNGT-FVKLNKASVNMLRIVEPYIAW-GYPNLKSVNELIYKR
R..YRTEI.M.R.ARKAGNFYVP.EP.L...VIRIR......PK.V.KVLQLLRL.Q.F..T.FVKLNKASVNMLRI...YIAW.GYPNLK.VN.LIYK.
Retrocopy
RKVYRTEIQMVRIARKAGNFYVPMEPRL/GLVIRIR-YQWCQPK\VSKVLQLLRLCQKFHST/FVKLNKASVNMLRIM-VYIAW\GYPNLKPVNKLIYKG


Parental protein
GYGKINKKRIA-LTDNTLIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN
GYGKIN.K....L.DNTLIA.SLGKYG.IC.E......YTVGK.FKEANNF..PFKLS.PR.G.K..T.HFV.GG.AG..E.QINRLIRRMN
Retrocopy
GYGKIN*KQTT/LKDNTLIA*SLGKYGSICREVALIQVYTVGKHFKEANNF*GPFKLSFPRWGRKMTTSHFVQGGNAGKVEVQINRLIRRMN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide