RetrogeneDB ID:
retro_mputfur_1158
Organism:
Location:
GL897028.1:6075055-6075319 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.05 %
Coverage:
69.29 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
POLR2F
Parental gene aliases:
No gene alias available
Parental gene description:
polymerase (RNA) II (DNA directed) polypeptide F [Source:HGNC Symbol;Acc:9193]

Genomic region (view in browser)





>retro_mputfur_1158
CCTCTCTGGAGAGAACCATGGACCTACCAGAAATGAATCACCACACCATATTTGATCAAG
TATGAGTGAACCAGCATGCTAGGCACCTGAGCCCTCCAGGTAATGACACGTGCCCCTGTG
CTGGTGGAACTGGAGGGCGAGACAGATCCCCTGCTCATCACCATGAAAGAGCTCAAGGTC
TGGAAAGTCTCCATCATCATTCGCTGCTACCTGCCAGACAGGAGCTATGAAGACTGGGGG
GTAGATGGGCTTATCATCACCAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
P....P...QK.ITTPY..KYE....LGT.ALQ....APV.VELEGETDPLLI.MKELK..K..IIIR.YLPD.SYEDWGVD.LIIT.
Retrocopy
PLWREPWTYQK*ITTPYLIKYE*TSMLGT*ALQVMTRAPVLVELEGETDPLLITMKELKVWKVSIIIRCYLPDRSYEDWGVDGLIITN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide