RetrogeneDB ID:
retro_mputfur_1161
Organism:
Location:
GL897029.1:1142964-1143285 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.64 %
Coverage:
85.6 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
Trmt112
Parental gene aliases:
No gene alias available
Parental gene description:
tRNA methyltransferase 11-2 [Source:MGI Symbol;Acc:MGI:1914924]

Genomic region (view in browser)





>retro_mputfur_1161
CCTAACAAAACCCCGCTGGCCTGGCAGGCCACATAGGTCTCCATCAACCCCATGGAGTTC
AACCCAGACTTTCTGGCATGTATGATACCCGAGGTAGAATGGGCGTTGCTTCTGGAGGCG
GCGGATACCTTACATCTGGTGGAGGTGCCCAAGGGGCTGACTGAAGGGTATGAACACAAT
GAGAAATTCCTGAGGGAGATGCACCAAGTTCTGCTGGAGGTGGAAGTGCTGGAGGGCACC
TTGAAGTGTTCAGAATCTAGAGGTCTGTTCCCCATCAGTTGGGGAATCCCTAACATGCCG
CTGAGTGATGAGGAAATGGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PRGFPLRLQATEVRINPVEFNPDFVARMIPKVEWAALLEAADTLHLVEVPKGPIEGYEHDEKFLRQMHHVLLEVDVLEGTLQCPESGRLFPISRGIPNML
P...PL..QAT.V.INP.EFNPDF.A.MIP.VEWA.LLEAADTLHLVEVPKG..EGYEH.EKFLR.MH.VLLEV.VLEGTL.C.ES..LFPIS.GIPNM.
Retrocopy
PNKTPLAWQAT*VSINPMEFNPDFLACMIPEVEWALLLEAADTLHLVEVPKGLTEGYEHNEKFLREMHQVLLEVEVLEGTLKCSESRGLFPISWGIPNMP


Parental protein
LSDEETE
LSDEE.E
Retrocopy
LSDEEME


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide