RetrogeneDB ID:
retro_mputfur_1162
Organism:
Location:
GL897029.1:2574017-2574941 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.17 %
Coverage:
71.66 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
ENO1
Parental gene aliases:
No gene alias available
Parental gene description:
enolase 1, (alpha) [Source:HGNC Symbol;Acc:3350]

Genomic region (view in browser)





>retro_mputfur_1162
ATGTCTGTTCTCAAGATCCATGCCAGAGAGATCTTTGACTCTCGTGGGAATCCCACCGTT
GAGGTTGACCTCTACACCTCTAAAGGTCTCTTCAGAGCTTTGTGCCCAGTGGTGCGACCA
CTGGTATCTACGAGGCCCTCAAGCTCTGGGACAATCCCCACTACATAGGGAAAGTTGTCT
CAAAGGTTGTTGAGCACATCAATAAAACTATTGCTCCTGCCCTGATTAGCAAGACACTGA
ATGTCGTGGAGCAAGAGAAAACTGACAGACTGATGATCGAGATGGATGGAACAGAAAATA
AATCTAAATTTGGTGCGAACACCATTCTGGGTGTGATCCTGGCTGTCTGCAAGGCAGGGG
CTGTCGAGAAGGGGGTGCCTCTGTACCGCCACACTGCCGACTTGGCAGGCAATTCCGAAG
TCATCCTGCGGGTTCTGGCTTTCAACGTCCCCAACGGTGGCTTCCACGCCAGCAACAAGC
TGGTCAAGCAGGAGTTCATGATCCTGCCTGTGGGTGCAGCTGGCTTCTGGGAGGCCATGC
GCATCAGGGCTGAGGTCTACCACAACCTGAAGAATGTTATCAAGGAGAAATACGGGAAGG
AGCCACCAACGCGGGGGATGAAGGCAGGTTTGCACCTAACATCCTGGAGAACAAAGAAGC
TCTGGAGCTGCTGAAGAATGCCATCAGGACAGCCGGCTACACTGACAAGGTGGTCATGGC
ATGGAAGTAGCTGCCTCAGAGTTCTTCTGGTCGGGCAAGTATGACCTGGACTTTAAGTCT
CCCAATGACCCCAGCAGGTACTTCATGTCCGACGAGCTGGCCAACTTATACAAGCCCTTT
ATCAAGGATTACCCAGTGGTGTCCATTGAAGACCCCTTTGACCAGGATGACTGGGAAGCT
TGGCAGAAGTTCACTGCCAATGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSILKIHAREIFDSRGNPTVEVDLYTAKGLFRAA-VPSGASTGIYEALELRDNDKTRYMGKGVSRPVKYINEFLAPALCTQKVNVVEQEKIDRLMIEMDG
MS.LKIHAREIFDSRGNPTVEVDLYT.KGLFRA..VPSGA.TGIYEAL.L.DN....Y.GK.VS..V..IN...APAL.....NVVEQEK.DRLMIEMDG
Retrocopy
MSVLKIHAREIFDSRGNPTVEVDLYTSKGLFRAL/VPSGATTGIYEALKLWDNP--HYIGKVVSKVVEHINKTIAPALISKTLNVVEQEKTDRLMIEMDG


Parental protein
TENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNAEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAASFREAMRIGAEVYHNLKNVIKEK
TENKSKFGAN.ILGV.LAVCKAGAVEKGVPLYRH.ADLAGN.EVIL.V.AFNV.NGG.HA.NKL..QEFMILPVGAA.F.EAMRI.AEVYHNLKNVIKEK
Retrocopy
TENKSKFGANTILGVILAVCKAGAVEKGVPLYRHTADLAGNSEVILRVLAFNVPNGGFHASNKLVKQEFMILPVGAAGFWEAMRIRAEVYHNLKNVIKEK


Parental protein
YGKD-ATNVGDEGGFAPNILENKEALELLKNAIGKAGYTDKVVI-GMDVAASEFFRSGKYDLDFKSPDDPSRYITPDELANLYKSFIKDYPVVSIEDPFD
YGK..ATN.GDEG.FAPNILENKEALELLKNAI..AGYTDKVV..GM.VAASEFF.SGKYDLDFKSP.DPSRY...DELANLYK.FIKDYPVVSIEDPFD
Retrocopy
YGKE/ATNAGDEGRFAPNILENKEALELLKNAIRTAGYTDKVVM/GMEVAASEFFWSGKYDLDFKSPNDPSRYFMSDELANLYKPFIKDYPVVSIEDPFD


Parental protein
QDDWEAWQKFTASA
QDDWEAWQKFTA.A
Retrocopy
QDDWEAWQKFTANA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide