RetrogeneDB ID:
retro_mputfur_1163
Organism:
Location:
GL897030.1:2243820-2244164 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
60.0 %
Coverage:
51.54 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
AK3
Parental gene aliases:
No gene alias available
Parental gene description:
adenylate kinase 3 [Source:HGNC Symbol;Acc:17376]

Genomic region (view in browser)





>retro_mputfur_1163
GGCAGAGAAATTGGCAGGTTAGCCAAGACTTTCACTGAACAAGGGAAGCTCATTTTGGAC
AATGTCATGACTCAGCTTGGCCCTTCATGAGCTGAAAAATCTCACCCAGTATAGCCGGCT
ACTGGATAGTTTTCCAAAGAACTTTCACAGGCAGAAGCCCTGGATAGTTTATCAGATAGA
GTGATTAATCTCAACATGACCTTTGAGGTCATGAAGCAACATCCATTGCTTCCTCAATTC
ATCCATCTAGTCACCAAGTCTCCAACATCAAATTCGACTCTCCCAATACCATGGGCCTTG
GTGATCTGACTGGAGAGCCTCTCATCCAGTGTGAGAGTAACAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GTEIGVLAKTFIDQGKLIPDDVMTRL-ALHELKRLTQHSWLLDGFPRT-LPQAEALDRAYQIDTVINLNVPFEVIKQR-LTARWIHPASGRVYNIEFNPP
G.EIG.LAKTF..QGKLI.D.VMT.L.ALHELK.LTQ.S.LLD.FP...L.QAEALD.....D.VINLN..FEV.KQ....A..IHP.S..V.NI.F..P
Retrocopy
GREIGRLAKTFTEQGKLILDNVMTQL\ALHELKNLTQYSRLLDSFPKN/LSQAEALDSLS--DRVINLNMTFEVMKQH/SIASSIHPSSHQVSNIKFDSP


Parental protein
KAVGIDDLTGEPLIQRDDDK
...G..DLTGEPLIQ.....
Retrocopy
NTMGLGDLTGEPLIQCESNR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide