RetrogeneDB ID:
retro_mputfur_1164
Organism:
Location:
GL897030.1:3461196-3461472 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.14 %
Coverage:
51.11 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
HMGN3
Parental gene aliases:
No gene alias available
Parental gene description:
high mobility group nucleosomal binding domain 3 [Source:HGNC Symbol;Acc:12312]

Genomic region (view in browser)





>retro_mputfur_1164
ATGCCCTGATCAAAGCCTCCAGAGAATACAGAGGGCGAGGATGGATCCAAAGCAACGAAA
TAGGAGACCACCAGACTGTCTGCCAGGTTGTCTGCAAAACCCACTCCACCAAAACCTAAA
CCTAAACCAGGAAGAATATCTGCGCACAAAGAACCTGGAACGAAGACTGACAAAGGTACT
TAAAGGAAAGAGGGAAGGTGTGAGGCTGGAAAGGAAGGTCCTGCACCATTTCCAGAGGAA
ATGGGGAAACGAAAGCAGAAGGTGCACATAAAACAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTPAKKEPGTKINKGAKGKKEEKQEAGKEGTAP-SENGETKAEEIHISR
MP..K.PENTEG.DGSK.TK.E.TR.SARLSAKP.PPKP.PKP....A.KEPGTK..KG....KE...EAGKEG.AP..E.........HI..
Retrocopy
MP*SKPPENTEGEDGSKATK*ETTRLSARLSAKPTPPKPKPKPGRISAHKEPGTKTDKGT-*RKEGRCEAGKEGPAPFPEEMGKRKQKVHIKQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide