RetrogeneDB ID:
retro_mputfur_1167
Organism:
Location:
GL897030.1:2951893-2952396 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.37 %
Coverage:
79.52 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
HMGB2
Parental gene aliases:
No gene alias available
Parental gene description:
high mobility group box 2 [Source:HGNC Symbol;Acc:5000]

Genomic region (view in browser)





>retro_mputfur_1167
GGCAAAGGAGATCCTAAAAAGCTGAGAGGCAAAATGTCATCATCATATGCATTTTTTGTG
CAAACTTAACGAGAGGAGCATAAAAAGCAGCACCCAAATGCTTCAGTCAACTTCTCTGAT
TTTTCTAAGAAGTGCTCAGAAAGGTGGAAGACCATGTCTGCGAAAAAGAAGGAAAATCTG
AAGACATAGCAAAGGAGGACAAGGCCCATTATGAAAGAGAAATGAAAACTTATATTCCCT
CTAAAGGGAAAACGAAAAAGAAGTTCAAGGATCCCAATGCACCCAAGAGGCCTCTGTTGG
CTTTTTTCTTGTTTTGTTCTGAGTATCGCCCCAAAACCAAAGGAGAACATCCTGGCCTAT
ACACTGGTTATGTTGGAAAGAAACTGGGAGAAATGTGGAATAACACTGCTGCAGATGACA
AGCAGTCTTAGGAAAAGAAGGCTTCTAAGCTGAAGGAAAAATATGAAAAGGATATTGCTG
TATACCGAGCTAAAGGAAAAGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GKGDPNKPRGKMSS-YAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKS-KFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPP
GKGDP.K.RGKMSS.YAFFVQT.REEHKK.HP..SVNF..FSKKCSERWKTMSAK.K..K.ED.AK.DKA.Y.REMK.Y.P.KG..K.K.KDPNAPKRP.
Retrocopy
GKGDPKKLRGKMSSSYAFFVQT*REEHKKQHPNASVNFSDFSKKCSERWKTMSAKKKE/KSEDIAKEDKAHYEREMKTYIPSKGKTKKKFKDPNAPKRPL


Parental protein
SAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKS
.AFFLFCSE.RPK.K.EHPGL..G...KKLGEMW....A.DKQ..E.KA.KLKEKYEKDIA.YRAKGK.
Retrocopy
LAFFLFCSEYRPKTKGEHPGLYTGYVGKKLGEMWNNTAADDKQS*EKKASKLKEKYEKDIAVYRAKGKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide