RetrogeneDB ID:
retro_mputfur_1169
Organism:
Location:
GL897032.1:4388355-4388971 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.43 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
RAB7A
Parental gene aliases:
No gene alias available
Parental gene description:
RAB7A, member RAS oncogene family [Source:HGNC Symbol;Acc:9788]

Genomic region (view in browser)





>retro_mputfur_1169
ATCACCTCTAGGAAGAAAGTGTTGCTGAAGGTTGCCATCCTGGGAGATTCTGGAGTTGGT
AAGACATCACTCAAGAACCAGTATGTAAAAAAGAAATTCAGTAATCAGTACAAAGCTACC
ACAGGAGCAGACTTTCTGACAAAGGAGGTGATGGTGGATGATAGACTAGTTATGAAGCAG
ATCTGGGACACAGCAGGCCTGGAGCGGCTCTAGCCCCTCAGTGTGGCCTACAGAGGTGCA
GACTGCTGTGTTCTGGAGTGTGACGTTACTGGCCCCAGCACCTTCAAAACTCTCCACAGC
TAGAGAGATGAATTCTCATCCCAACCAGTCCCCGGGATCCCAGAAACTTCCCCTTCATTG
TGTTGGGAAACAAGACTGACCTTGAAAACAGACAAGTGGCCACAAAGTGGCCACAGGCCG
GGTGCTACAGCAAAAACAACATTCCCTACGTCAAGACCAGTGCCAAGGAGGCCATCAGTG
TGGAGCTGGCATTCAGACAATCGCACGGAATGCACTCACACAGGAAACAGAGGTAGAGCG
GTACAGTGAGTTCCCCGAGCCCATCAGACTGGACAAGAACAGCCAGGCCATGGCCTCAGT
GGAGAGCGGCAGGTGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLD
.TSRKKVLLKV.ILGDSGVGKTSL.NQYV.KKFSNQYKAT.GADFLTKEVMVDDRLV..QIWDTAG.ER...L.VA.YRGADCCVL..DVT.P.TFKTL.
Retrocopy
ITSRKKVLLKVAILGDSGVGKTSLKNQYVKKKFSNQYKATTGADFLTKEVMVDDRLVMKQIWDTAGLERL*PLSVA-YRGADCCVLECDVTGPSTFKTLH


Parental protein
SWRDEF-LIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAF-QTIARNALKQETEVELYNEFPEPIKLDKNDRA
S.RDEF.LI..SPRDP.NFPF.VLGNK.DLENRQVATK..QA.CYSKNNIPY..TSAKEAI.VE.AF.QTIARNAL.QETEVE.Y.EFPEPI.LDKN..A
Retrocopy
S*RDEF/LIPTSPRDPRNFPFIVLGNKTDLENRQVATKWPQAGCYSKNNIPYVKTSAKEAISVELAF/QTIARNALTQETEVERYSEFPEPIRLDKNSQA


Parental protein
KASAESCSC
.AS.ES..C
Retrocopy
MASVESGRC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide