RetrogeneDB ID:
retro_mputfur_1170
Organism:
Location:
GL897033.1:5213030-5213384 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.1 %
Coverage:
94.26 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_1170
TTCAGAATGGTCCAGCGTTTGACATACCATTATAGAGTGTCCTACAATACAGCCTCTAAC
AAAACTAGGTTGTCCCGAACCCTTGGTAATATAATTGTTTACCTTTATACCTAGAAGGTT
GGAAAAGCACCCAAATTCTCTTCTGGCATGTGCCTTAGCTGACTTTCAGGAGTTCATGCT
ATAAGACCTGTAGTTTTTAAGAAGTTGTCTAAAATGGAAAAAAAAATATATCATGTCAGC
AGGGTCTATGATGGTTCCATATGTGCTAAATGTGTTCGTGATGGAATCAATCATGATTTC
CTTACTGCAGAGCAGAAAATCATTGTGAAAATGTTGCAGGCATAAGCACAGAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FRMVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKK---HVSRAYGGSMCAKCVRDRIKRAF
FRMVQRLTY..R.SYNTASNKTRLSRT.GN.IVYLYT.KVGKAPK...G.C...L.GV.A.RP.V...LSK......HVSR.Y.GS.CAKCVRD.I...F
Retrocopy
FRMVQRLTYHYRVSYNTASNKTRLSRTLGNIIVYLYT*KVGKAPKFSSGMCLS*LSGVHAIRPVVFKKLSKMXXXXYHVSRVYDGSICAKCVRDGINHDF


Parental protein
LIEEQKIVVKVLKAQAQS
L..EQKI.VK.L.A.AQ.
Retrocopy
LTAEQKIIVKMLQA*AQN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide