RetrogeneDB ID:
retro_mputfur_1175
Organism:
Location:
GL897034.1:2058551-2059052 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.88 %
Coverage:
56.23 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
NT5C3A
Parental gene aliases:
No gene alias available
Parental gene description:
5'-nucleotidase, cytosolic IIIA [Source:HGNC Symbol;Acc:17820]

Genomic region (view in browser)





>retro_mputfur_1175
TTAAATCACATGATGGCAGAATCTGATGTTATGCTCAAGGAAGAGTATGAGAATTTCTTT
GATAAACTCCAGCGATACAGTATTTCTGTGTTCATATTTTTAGCTGGTATTGGTGTTATG
CTGGAGGAGGTAGTCCATCAGGCTAGCGTTTATCACCCAAACATCACAGTAGTGTTCGGC
TTCATGGATTTTGATGGTAATGGGGGTGCTCAAAGGATTTAAAAGCAAACTAATTTCTTT
ATTTAACAAACATGATGGTGCCTCGAAGAATACAGAATATTTCAATTGATGAAAAGAAAA
TAGCAACTAACTCTGCTGGGAGATTCTCAAGGGGATATAAGAATGGCAGATGAAGTAGCT
AATGTTGAACACATTCTGAAAATTGGATATCTAAATGATAGGGTGGAAGAGCTTTTTAAA
AAGTACATGGACTCTAATGACATTGTTTTAGTAAAAGATGAATCTTTGGATGTAGCCAAC
TCTGTCTTACAGAAGATTCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LKEIVAESDVMLKEGYENFFDKLQEYGIPVFIFSAGIGDILEEVIHQAGVYHPNITVVSNFMDFDDN-GVLKGFKGELIHVFNKHDGALKNTEYFNRLKD
L....AESDVMLKE.YENFFDKLQ.Y.I.VFIF.AGIG..LEEV.HQA.VYHPNITVV..FMDFD.N.GVLKGFK..LI..FNKHDGA.KNTEYFN..K.
Retrocopy
LNHMMAESDVMLKEEYENFFDKLQRYSISVFIFLAGIGVMLEEVVHQASVYHPNITVVFGFMDFDGN\GVLKGFKSKLISLFNKHDGASKNTEYFN**KE


Parental protein
NSN-IILLGDSQGDIRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKDESLDVANSILQKIL
NSN...LLGDSQGDIRMAD.VANVEHILKIGYLNDRV.EL..KYMDS.DIVLVKDESLDVANS.LQKIL
Retrocopy
NSN/LTLLGDSQGDIRMADEVANVEHILKIGYLNDRVEELFKKYMDSNDIVLVKDESLDVANSVLQKIL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide