RetrogeneDB ID:
retro_mputfur_1184
Organism:
Location:
GL897037.1:225131-225507 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.48 %
Coverage:
79.75 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
AP1S1
Parental gene aliases:
No gene alias available
Parental gene description:
adaptor-related protein complex 1, sigma 1 subunit [Source:HGNC Symbol;Acc:559]

Genomic region (view in browser)





>retro_mputfur_1184
CTGGCCACGGCAGACACGCCGCGAAGGACCGCGGCTCCGGAGCTTATGCAGGTCGTTCCG
GCTTGCAAGCCCATGATGTGCAGCTTCCCGGAGGAGAAGGACCTCAAAGCCGTCTATAAA
AGATACGCCAGCCTCTACTGCTGCGCCGTGGAGCGCGTGGACGATGCACTCGTCCTGCCG
GAGCCGATGCGCCGAGGTGTGAAGCTGCTGGACTCCTACTTCCGCAGCGCGTGCGAGATG
GACTTCGGCTTTAACCTTGAGAAGGCCGGCTTCCTCCGGCATGAGATTTCGATGGGGGGA
TGAAATCCAGGACAGCTTCAGAGAGCGTGTGCTGAAGGCCATGAGGCAGGCTGACCTGCT
GCAGGTGGAGGAGGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG
LAT.D..R.....ELMQVV.A.KP.MCSF.E..DLK.VYKRYASLY.CCA.E..D..L...E...R.V.LLD.YF.S.CE.D..FN.EKA.F...E..MG
Retrocopy
LATADTPRRTAAPELMQVVPACKPMMCSFPEEKDLKAVYKRYASLY-CCAVERVDDALVLPEPMRRGVKLLDSYFRSACEMDFGFNLEKAGFLRHEISMG


Parental protein
G-DVQDTSKKSVLKAIEQADLLQEEDE
G...QD.....VLKA..QADLLQ.E.E
Retrocopy
G\EIQDSFRERVLKAMRQADLLQVEEE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide