RetrogeneDB ID:
retro_mputfur_1185
Organism:
Location:
GL897037.1:1100691-1101226 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.85 %
Coverage:
63.41 %
Frameshifts:
1
Stop codons:
5


Parental gene:
Parental gene symbol:
TRNAU1AP
Parental gene aliases:
No gene alias available
Parental gene description:
tRNA selenocysteine 1 associated protein 1 [Source:HGNC Symbol;Acc:30813]

Genomic region (view in browser)





>retro_mputfur_1185
TTTAAACTGAGCTATGCCACTTATAGGAAACAACCAGATAACAGCCTTGAGTATTCCTTC
TTTGCGGGGGACCTGACCCCAGATGTGGATGATGATGTGCTATATGAATTCTTCATCAAA
GTTTACCCCTCCTATTAGGGAGGCAAGGTGATTTTGCCTCCAAACAGCTGTGTCTAAAGA
CTATGGTTTTGTGAAAACCACAGATGAACTGGAACAGAAGTGAGCCTTGACTGACTGCCA
AGGAACAGTCGTCCTGGAGCCTAAACCAGTGCAGCTGAGCATGGCAATCCTCAAAGCAAG
CCAAATGATGTCAGTGGAGTATAGTCAGATTTACAGTTACAGCTGCAATCACTATTACCA
GTAATGCAAGAACTGTTATAGTTACCAGAATACAAGCAGCTACAGCTATGGCTATACCTA
GTATGGTTATACCCAGAGCACTGTGTAGGGATATCAAGAAGTTAGGGATTACACATTGGA
AGACCCCATGCTACATCTGGATGTGATTGAGGCCAACAAGGAGTTCATGGAGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKA
FKL.YATY.KQPDNS.EYS.F.GDLTPDVDD..LYEFF.KVYPS..GGKV.L..QT.VSK.YGFVK.TDELEQK.ALT.CQG.V.L..KPV.LS.AI.KA
Retrocopy
FKLSYATYRKQPDNSLEYSFFAGDLTPDVDDDVLYEFFIKVYPSY*GGKVILP\QTAVSKDYGFVKTTDELEQK*ALTDCQGTVVLEPKPVQLSMAILKA


Parental protein
SRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVVEANKEFMEQ
S....VEYSQ.YSYS.N.YYQ...N.Y......QNT.SYSY.Y..YGYTQST...Y.EV.D..LEDPM..LDV.EANKEFME.
Retrocopy
SQMMSVEYSQIYSYSCNHYYQ*CKNCYSY----QNTSSYSYGYT*YGYTQSTV*GYQEVRDYTLEDPMLHLDVIEANKEFMEE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide