RetrogeneDB ID:
retro_mputfur_1187
Organism:
Location:
GL897038.1:872182-872394 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.61 %
Coverage:
77.17 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
LAMTOR5
Parental gene aliases:
No gene alias available
Parental gene description:
late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 [Source:HGNC Symbol;Acc:17955]

Genomic region (view in browser)





>retro_mputfur_1187
ATCCTGGGCATGGGTTCCTAAGGTCTCAATCTGGGCTGCTGTGAGATCCTGTCAGATGAG
CATGCTGGGTAATACTTGTTCTAGCCCAGCAAGCAGCTGGGCTGGCCTCAGACCCCACTG
TTACTCCTGTGGTATGCCTAGAATCAGATAACAGGAATATCATTCTCCAGAAACATGATG
GTATCACAGTGGCTGTCCACAATAAGGCTTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VLCTDSQGLNLGCRGTLSDEHAG-VISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
.L...S.GLNLGC...LSDEHAG.VI.VLAQQAA.L.SDPT..PVVCLESDN.NI..QKHDGITVAVH..AS
Retrocopy
ILGMGS*GLNLGCCEILSDEHAG/VILVLAQQAAGLASDPTVTPVVCLESDNRNIILQKHDGITVAVHNKAS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide