RetrogeneDB ID:
retro_mputfur_1190
Organism:
Location:
GL897039.1:25507-25996 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.0 %
Coverage:
77.1 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
RAN
Parental gene aliases:
No gene alias available
Parental gene description:
RAN, member RAS oncogene family [Source:HGNC Symbol;Acc:9846]

Genomic region (view in browser)





>retro_mputfur_1190
CATTCCAATAGAGGACCTACTAAATTCAATGTAGGGAATATGGCTGGTCAGGAGAAAATT
GGTAGGCTGAGAGATGGTACTACATCCAAGTCCAGCATGCCATGATAAGGTTTGATGTAA
GAGCAAGGGTTTCTTACAAGAATGTGTATAACTGACACAGAGATCTGGTATGAGTATGTG
AAAACATCCCCATTGTGCTGCGTGGCAATAAAGTAGACATTAAGGACAGGAAAGTTAAGG
CCAAATCTATTGTCTTCCACGAAAAGAAAACCTTCAGTACTAGGACATTTCTGCCAAAAG
CGACTATAACTTTGAAAAGTCCTTCCTCTCTCTTGCTTGAAAACTATTTGGAGACCCTAA
CTTGGAGTCTGTTGTTGTGACAGCTATTGTCCTACCAGAGGTTGCCTGGACCCAGCTTTG
GCAACACAGTATGAGCAGGATCTAGAGGTTGCTCAGACAAAGGTTCTCCCAGATGAGGAT
GATGACCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HTNRGPIKFNVWDTAGQEKFGGLRDG-YYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFH-RKKNLQQYYDI
H.NRGP.KFNV...AGQEK.G.LRDG.YYIQ.Q.A.I.FDV..RV.YKNV.N.HRDLV.VCENIPIVL.GNKVDIKDRKVKAKSIVFH.RK.NL.QY.DI
Retrocopy
HSNRGPTKFNVGNMAGQEKIGRLRDG/YYIQVQHAMIRFDVRARVSYKNVYN*HRDLV*VCENIPIVLRGNKVDIKDRKVKAKSIVFH/RKENL-QY*DI


Parental protein
SAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVV-MDPALAAQYEHDLEVAQTTALPDEDDDL
SAKS.YNFEK.FL.LA.KL.GDPNLE.V...A...PEV...DPALA.QYE.DLEVAQT..LPDEDDDL
Retrocopy
SAKSDYNFEKSFLSLA*KLFGDPNLESVVVTAIVLPEVA/LDPALATQYEQDLEVAQTKVLPDEDDDL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide