RetrogeneDB ID:
retro_mputfur_1191
Organism:
Location:
GL897039.1:3671616-3672051 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.17 %
Coverage:
97.32 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
STMN1
Parental gene aliases:
No gene alias available
Parental gene description:
stathmin 1 [Source:HGNC Symbol;Acc:6510]

Genomic region (view in browser)





>retro_mputfur_1191
GTGGCTGCTTCTGATACCCCAGGGAAAAAACTGGAGAAACATGACTCAGGCCAAGCTTTT
GGGTTGATTCTCAGCCCTCAACCAAAAGAACTCATCCCAGAATTCCCCCTTTCCCCTCCA
AGGAAAAAGGATCTTTCTCTAGAGGAAATTTGGAAGAAATCAAAAGCTGCAGAAGAAAAA
AACAAGTCCCATAAAGCGGAGGTCTTGAAGCAGCTTGCTGAGAAATGACAGCATGAGAAA
GAAGTGCTTCAAAAAGCAACAGAAGAAAAGAACAACTTCAGTAGAATGGCAGAAGAAAAA
CTGACTCACAAAATGAAGGCCAACAAAGAGAATCAGGAGGCATAAATGGCTGCCAAACTG
GAGCGCTTCTGAGAGAAGGACAAGTACATGGAAGAAGTGTGGGCAAACAAAGAATCCAAA
GATCCTATTGATAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEK
.A.SD...K.LEK..SGQAF.LILSP..KE..PEFPLSPP.KKDLSLEEI.KK..AAEE..KSH.AEVLKQLAEK..HEKEVLQKA.EE.NNFS.MAEEK
Retrocopy
VAASDTPGKKLEKHDSGQAFGLILSPQPKELIPEFPLSPPRKKDLSLEEIWKKSKAAEEKNKSHKAEVLKQLAEK*QHEKEVLQKATEEKNNFSRMAEEK


Parental protein
LTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADE
LTHKM.ANKEN.EA.MAAKLER..EKDK..EEV..NKESKDP.D.
Retrocopy
LTHKMKANKENQEA*MAAKLERF*EKDKYMEEVWANKESKDPIDK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide