RetrogeneDB ID:
retro_mputfur_1193
Organism:
Location:
GL897039.1:989984-991130 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.28 %
Coverage:
74.08 %
Frameshifts:
6
Stop codons:
3


Parental gene:
Parental gene symbol:
FAM98A
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 98, member A [Source:HGNC Symbol;Acc:24520]

Genomic region (view in browser)





>retro_mputfur_1193
CAGGAAGGAGGTAGTCATGAGGTCTTTCAAGAGTTGAAAGGCATATGTATTGCTCTAGGA
ATGTCCAATCCTCCAGCCAATATAACTATGTTCCAGTTCTTCAGTGGGATTGAAAAAAAT
TAAAGGAGACATTAGCAAAGGTTCCACTTAACCATGTGGAAAGCCTTTATTGAAGAAACC
AATGAGACCAGCCCACTGGGAAAACAAAGAAGCAGTTAACCAGGCCATAGCTAATGAACA
TGAAGTTCTGAGAAAGCTGCTATTAAAAGGCTTAGATGTCACTGTCCAGTCTTTTGGTTG
GTCTGACAGAGCTAAGAGTCAGACAGAAAAAATAGCAAAGGTTTACCAGCTGAAATGCTC
AGTCCTATCTCCTAAAAGTATTATTTCTGTTCCCATGTTTTGGCTATAAGACAAGACTCA
TCAAAGATTTTAAGGACAAGCAGTAACTCTATAAAAGAAAAGACTGCCTTGGCCATCAAT
AAAATGTTGTTGGGTAGGGTGCCTGACAGAGGAGGTAGACCCAATGAAATTGGACCTCTA
CCTCCAGAGATGCCACCATGGCAGAAAAGGTAAGACGGCCCCCAACAACAAGCAGGAGGC
CAACAAGGAGGAGAGGTGGTTATGAACATTCCTCATATGAAGGTCGAGGAGGTCATGAAC
AAAGAGGAGGGAGAGGTGGGTGCGGTGGCTATGACCATGATAGCTAGGGGGAGGGAGAGA
AAATAAGCATCAAGGAGGCTGGACGGATGGAGAGAATGGAAAAGGAGGTGGTGGCTACCA
AGATGGTGGTCATCGAGATTCGGGTTTCCAGCCAGGTGGCTATCATGGTGGTGGCTGCTG
TGGTAGCTATCAAGGTGATGGTTATGGTGACTTCCAAACATCTACATACATAAAAAGTGG
ATACTGGGGTAGTGGATACCAGCAGGACAGTAGATACCAAGATGGTGGTCACCATGGTGA
CTGAGGCAGTGGTCGTGGAGGGAGAAGTGGTTGTAGAAGCCAAGGTGGATGTGGAGGCCA
GAAAGAAGTTGGGGAGGAAGGGGGAGCCAGAATTATCACCAAGGGGCCCAATTTGAATAG
CACTTCCAGCATGGAGGTTATCAGTGTAATCATTTTGGATTTGATCAGGGAAGACATTAT
CCTAGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEK-KLKETLAKVPPNHV-GKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLLIKRLDVTVQS
QEGG..EVFQELKGICIALGMS.PPANITMFQFFSGIEK.KLKETLAKVP.NHV.GKPLLKKPM.PAHWE..EA.NQAIANE.EV.RKLL.K.LDVTVQS
Retrocopy
QEGGSHEVFQELKGICIALGMSNPPANITMFQFFSGIEK/KLKETLAKVPLNHV/GKPLLKKPMRPAHWENKEAVNQAIANEHEVLRKLLLKGLDVTVQS


Parental protein
FGWSDRAKSQTEKLAKVYQPKRSVLSPKSTISV-AHLLAARQDLSKILRTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQ
FGWSDRAKSQTEK.AKVYQ.K.SVLSPKS.ISV..H.LA.RQD.SKILRTSS.SI.EKTA.AINK.L.GRVPDRGGRPNEI.P.PPEMPPWQKR.DGPQQ
Retrocopy
FGWSDRAKSQTEKIAKVYQLKCSVLSPKSIISV/SHVLAIRQDSSKILRTSSNSIKEKTALAINKMLLGRVPDRGGRPNEIGPLPPEMPPWQKR*DGPQQ


Parental protein
QAGGRGGG-RGGYEHSSYGGRGGHEQGGGRGGRGGYDHGS-RGGGRGNKHQGGWTDGGSG-GGGGYQDGGYRDSGFQPGGYHGGSHSGSYQGGGYGGFQT
QAGG..GG.RGGYEHSSY.GRGGHEQ.GGRGG.GGYDH.S..GGGR.NKHQGGWTDG..G.GGGGYQDGG.RDSGFQPGGYHGG...GSYQG.GYG.FQT
Retrocopy
QAGGQQGG/RGGYEHSSYEGRGGHEQRGGRGGCGGYDHDS/LGGGRENKHQGGWTDGENGKGGGGYQDGGHRDSGFQPGGYHGGGCCGSYQGDGYGDFQT


Parental protein
STYTGSGYQGGGYQQDNRYQDGGHHNDRGSGRGGRGGRGGRGGRGGQ-GGGWGGRGSQNYHQGGQFEQHFQHGGYQYNHSGFGQGRHYTS
STY..SGY.G.GYQQD.RYQDGGHH.D.GSGRGGR.G....GG.GGQ....WGGRGSQNYHQG.QFE.HFQHGGYQ.NH.GF.QGRHY.S
Retrocopy
STYIKSGYWGSGYQQDSRYQDGGHHGD*GSGRGGRSGCRSQGGCGGQ/ERSWGGRGSQNYHQGAQFE*HFQHGGYQCNHFGFDQGRHYPS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide