RetrogeneDB ID:
retro_mputfur_1196
Organism:
Location:
GL897040.1:5800074-5800682 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.02 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
PSMB1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, beta type, 1 [Source:HGNC Symbol;Acc:9537]

Genomic region (view in browser)





>retro_mputfur_1196
ACTGTATTGGTAATCGCAGGAGGAGATTTTTCAGTTGTTGCTTCTGACACTTGATTGAGT
GATGGGCTTTTAATTTGCACCTGGGATGGCCCCAGGTATTACAAATTAGCAGACAAAACA
GTCCCTGGATGCAGCGGTTTTCATGGAGACTGTCTTACCTTGACCAAGATTACTGAAGCA
AGACTAAAGACATGTAAGCATTCTAATAACAAGACCAGGACTACAGGGGCAGTTGCTGCA
ATGCTGTCCACCACCCTCCATTCAAGACCATTCTTTCTATATTATGTTTACTACATCATA
TGGGAACTGGATGAAGAAGGGAAAGGAGCTGTGTACGACTTTGACCTGGTCTGATTCTAC
CACTGAGACTCTTTCAAGGCTGGAGGCTCAGCAAATGCCATGCTACAGCCCCTGCTTGAC
CACCAGGTTGGTTTTAAGAGCAGGCAGAATATGGACCATGTCCCACTGTCCTTGGACAGA
GTCACGCATCTTGTGAAAGATGTCTTCACTTCTGTGGTGGAGAGGGATGGTTTTACTGGG
GATGCGCTCATATCTGCATCATGACTACGGAGGGCAGCAGGGAGGGGACTGTTCCCCTGT
GGAAGGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TVLAIAGEDFSIVASDTRLSEGYSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKTMTTGAIAAMLSTILYSRRFFPYYVYNII
TVL.IAG.DFS.VASDT.LS.G..I.T.D.P..YKL.DKTV.GCSGFHGDCLTLTKI.EARLK..KHSNNKT.TTGA.AAMLST.L.SR.FF.YYVY.II
Retrocopy
TVLVIAGGDFSVVASDT*LSDGLLICTWDGPRYYKLADKTVPGCSGFHGDCLTLTKITEARLKTCKHSNNKTRTTGAVAAMLSTTLHSRPFFLYYVYYII


Parental protein
GGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFVSAAERDVYTGDAL-RICIVTKEGIREETVP
..LDEEGKGAVY.FD.V..Y..DSFKAGGSA.AMLQPLLD.QVGFK..QN..HVPLSLDR...LVKDVF.S..ERD..TGDAL..ICI.T.EG.RE.TVP
Retrocopy
WELDEEGKGAVYDFDLV*FYH*DSFKAGGSANAMLQPLLDHQVGFKSRQNMDHVPLSLDRVTHLVKDVFTSVVERDGFTGDAL/HICIMTTEGSREGTVP


Parental protein
LRKD
L.KD
Retrocopy
LWKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide