RetrogeneDB ID:
retro_mputfur_12
Organism:
Location:
GL896982.1:6658550-6658904 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.31 %
Coverage:
95.9 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_12
ATGGTCCAGCGTTTGACCTACCGTCGTAGGCTGTCCTACAATACAGCCTCTAATAAAATT
AGGCTGTCCCGAACCCCAGGTAATAGAATCGTTTACCTTTATACCAAGAAGGTTGGGAAA
GCACCAAAATCTGCATGTGGCGTTTGCCCAGGCCGACTTCTAGGAGTTCATGCTGTGAGG
CCTAAAGTACTTATGAGGTTGTCTAAAACGAAAAAACATGTCAGCAGGGCCTACGGTGGT
TCCATGTGTGCCAGGTGTGTTCGTGACAGGGTCAAGCATGCTTTCCTTATCGAGGAGCAG
AAAATCGTTCTGGAAGTGTTGAAGGCACAAACACAGAGTCAGAAAGCAAAATAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQ
MVQRLTYRRRLSYNTASNK.RLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRL.GV.AVRPKVLMRLSKTKKHVSRAYGGSMCA.CVRDR.K.AFLIEEQ
Retrocopy
MVQRLTYRRRLSYNTASNKIRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLLGVHAVRPKVLMRLSKTKKHVSRAYGGSMCARCVRDRVKHAFLIEEQ


Parental protein
KIVVKVLKAQAQSQKAK
KIV..VLKAQ.QSQKAK
Retrocopy
KIVLEVLKAQTQSQKAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide