RetrogeneDB ID:
retro_mputfur_1201
Organism:
Location:
GL897041.1:816458-816965 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.37 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
SDHC
Parental gene aliases:
No gene alias available
Parental gene description:
succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa [Source:HGNC Symbol;Acc:10682]

Genomic region (view in browser)





>retro_mputfur_1201
ATGGCTGTGCTCTTGTTGAGACATGTTGGCTCTCATTGCCTCTGTGCCCATCTAAGTCCT
AGGCTCTGTATCAGAAATGCTGTTCCTTTGGGAACTATAACCAGAGAAAAGATGGAGAAG
TTCTGGAAAAAGAACACTACTTTAAACTGTATTCTGTCTCTGCATATCACTATCTACAGT
GGATCTCTTCCCATGGCAATATCCCTTTGGCACTCTGGTACTGGTATGACCTTGAGTACA
GAGGTCTTTCTCTTTGGCTTGTTGGCCCTCTTGGCTCTTGGCAACTTTCAATCTTATTTG
AAATTTGTAAAGACCATGTGTCTGGGGACATCACTGATCTACACAGCTGAATTTGCACTT
GTCTTCCCTCTCATGTATCATACCTAGAATGGGATCTAACACTTGATGTGGAACCTAAAG
AAAGGCCTGAAGATTCCCCAGCTATACCAATCTGGAGTGGTTGTCTTGGTTCTTACTGGA
TTGTCCTCTGCAGGGCTGACAGCCATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAALLLRNVGRHCLRAHLSPRLCTRNAVPLGTTAKEEMERFWNKNTDLNRPLSPHITIYSWSLPMAMSICHRGTGVALSAGVSLFGLSALLIPGNFESHL
MA.LLLR.VG.HCL.AHLSPRLC.RNAVPLGT...E.ME.FW.KNT.LN..LS.HITIYS.SLPMA.S..H.GTG..LS..V.LFGL.ALL..GNF.S.L
Retrocopy
MAVLLLRHVGSHCLCAHLSPRLCIRNAVPLGTITREKMEKFWKKNTTLNCILSLHITIYSGSLPMAISLWHSGTGMTLSTEVFLFGLLALLALGNFQSYL


Parental protein
ELVKSLCLGPSLIYTAKFALVFPLMYHTWNGIRHLVWDLGKGLKIPQLYQSGVAVLVLTVLTSAGLAAM
..VK..CLG.SLIYTA.FALVFPLMYHT.NGI.HL.W.L.KGLKIPQLYQSGV.VLVLT.L.SAGL.AM
Retrocopy
KFVKTMCLGTSLIYTAEFALVFPLMYHT*NGI*HLMWNLKKGLKIPQLYQSGVVVLVLTGLSSAGLTAM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide