RetrogeneDB ID:
retro_mputfur_1202
Organism:
Location:
GL897041.1:1634641-1635087 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.72 %
Coverage:
51.16 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
FHL3
Parental gene aliases:
No gene alias available
Parental gene description:
four and a half LIM domains 3 [Source:HGNC Symbol;Acc:3704]

Genomic region (view in browser)





>retro_mputfur_1202
CTCACTCACAGCCACCACGAGGGAGGCTTGTGTGCAAAATGCGAGTCCCTGGAAGGCCAC
AAGTACATCCAGAAAGATGATGGCCCGTCCCCTGTGTCCTGCTATGAAAACACTTCACTA
CCACCTGTGCTGAGTGTCAGCAACTTATGGGGCTGACTCAATGGAGCCTTTTTATGAAGA
CTGCCACGTCCATGAGGGCTGCTGCTGCTGTCCTCGCTCCCTGGCCACTGAGCCCTTCAC
TTGTCAGGATAATGAGCTGCTCTGTAATGCTTGCTACTGCAGTGACTTCTCCTCCCAGTG
CTCTGCCTATGGGAAGACCTCATGTCTGGGTCCCAGAAGCTGGAATACAGAGGCCAGAAG
TGGCATGAGCACTGTTTCCTGTGCAGTGGCTGTAAGCAGCTGCTGGGCTCCCATTCTTCA
TGCCCAAAAGGCATGCCCAGTATTGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LTATMSEAFDCAKCSESLYGRKYIQTDDGPYCVPCYDST-FANTCAECQQLIG-HDSRELFYEDRHFHEGCFRCCRCKRSLADEPFTCQDNELLCNDCYC
LT....E...CAKC.ESL.G.KYIQ.DDGP..V.CY..T.F..TCAECQQL.G..DS.E.FYED.H.HEG...CC.C.RSLA.EPFTCQDNELLCN.CYC
Retrocopy
LTHSHHEGGLCAKC-ESLEGHKYIQKDDGPSPVSCYENT/FTTTCAECQQLMG/ADSMEPFYEDCHVHEG---CCCCPRSLATEPFTCQDNELLCNACYC


Parental protein
SAFSSQCSACGET-VMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS-FVPDKGAHYC
S.FSSQCSA.G.T..M.GS.KLEY.GQ.WHEHCFLCSGC.Q.LGS.S.F.P...A.YC
Retrocopy
SDFSSQCSAYGKT/LMSGSQKLEYRGQKWHEHCFLCSGCKQLLGSHS/FMPKRHAQYC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide