RetrogeneDB ID:
retro_mputfur_1204
Organism:
Location:
GL897041.1:5490777-5491060 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.62 %
Coverage:
63.16 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS18
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S18 [Source:HGNC Symbol;Acc:10401]

Genomic region (view in browser)





>retro_mputfur_1204
GGCAGGAGAACTGAGGATGAGGTGGGGCGTGTGATCGCCATTATGCACAATCCTCACCAG
TGTAAGATCATAGGCAAAAGGTTTTTAAATAGACAAAAGGACATGAAGGATGGAAAACAC
AGCCAAGTCCTGACCATGGTCTAGATAACACACTTCATAAGATGGGGAGCAACTGAAGAA
GATTCAGGCCCACAGAAGGCTGTGCCACTTCTGGAAATGTCATGTCCAAGGCCATTAAAC
CAAAACCACAGGACACAGTGACTAAAAAGTGTCTAAGAAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GELTEDEVERVITIMQNPRQYKI-PDWFLNRQKDVKDGKYSQVLA-NGLDNKLRE-DLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK
G..TEDEV.RVI.IM.NP.Q.KI....FLNRQKD.KDGK.SQVL...GLDN.L...D.E.LKKI.AHR.L.HFW...V.G..TKTTG.....V..SKKK
Retrocopy
GRRTEDEVGRVIAIMHNPHQCKIIGKRFLNRQKDMKDGKHSQVLT/HGLDNTLHK/DGEQLKKIQAHRRLCHFWKCHVQGH*TKTTGHSD*KV--SKKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide