RetrogeneDB ID:
retro_mputfur_1207
Organism:
Location:
GL897042.1:3119343-3119671 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.44 %
Coverage:
75.17 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
CALM2
Parental gene aliases:
No gene alias available
Parental gene description:
calmodulin 2 (phosphorylase kinase, delta) [Source:HGNC Symbol;Acc:1445]

Genomic region (view in browser)





>retro_mputfur_1207
GTGGCTGATCAGCTGACCAAAGAACACATTGCTGAGTTCAAGGCAACTTTTCCCTCTCTG
ACAAAGATGGCAATGGCGCAACAGAGGAACTTGGAACTGTTATGAGGTCACTGAGTCAGA
AGCCAGCAGAAGCCTAATTGCAGGATATGATCAATGAGGTGGATGGTGATGGTAATGGCA
CCATTGAATTTTCAGAATTTTTGACTATGGGGGCTAGAAAAATGAAAGATACAGACAGTG
AAGAGGAAATCCGTGAAGTATTCGGAGTCTTGGCAAGGATGGGAATGGTTGTATCAGTGT
AGCAGAACTCTGTCATGTCATGACAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MADQLTEEQIAEFKEAF-SLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAF-RVFDKDGN
.ADQLT.E.IAEFK..F.SL.DKDG.G...T.ELGTVMRSL.Q.P.EA.LQDMINEVD.DGNGTI.F.EFLTM.ARKMKDTDSEEEIRE.F.R...KDGN
Retrocopy
VADQLTKEHIAEFKATF/SLSDKDGNGA--TEELGTVMRSLSQKPAEA*LQDMINEVDGDGNGTIEFSEFLTMGARKMKDTDSEEEIREVF/RSLGKDGN


Parental protein
GYISAAELRHVMTN
G.IS.AEL.HVMTN
Retrocopy
GCISVAELCHVMTN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide