RetrogeneDB ID:
retro_mputfur_1217
Organism:
Location:
GL897044.1:4980974-4981639 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.65 %
Coverage:
65.14 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
DMTN
Parental gene aliases:
No gene alias available
Parental gene description:
dematin actin binding protein [Source:HGNC Symbol;Acc:3382]

Genomic region (view in browser)





>retro_mputfur_1217
CTCATGATCTACAAGTTCCACTGTCCCTATTCCTTCCTGGAACACATGGAACGGCTCGGA
AGCCAAGATCTTGTTTTCACCAAATCCACGTCTCCCTCCCCCTTAGCATCCCCAGAAGTG
TGGGTAAAGAGCAGGACCTCTGGAACCATCTCCCAGGCTTTAGCCCCAAGAATTACCGGG
ACCCCCCAGAATACCCTGGCCCATTTCCCATCATCATCCTACTCAGATTCCCACATGTAT
AAGCAGACACAGATCCATAAGCAGAGAGAATCTGTGGATAGCAGCTCTCAGCACAAGCCT
TCTTCTGAGGATCTTGTCATCAAGTCATCCATGCTCCCTGCAGCCTAGCCCCGGACTCCA
ACCTGCTCACCAAGATTGAAATTGATTATTGGTTATGCAGTTTGTCACTGGCCATTGTGG
AGATAGAAAGAAAGAAGCAGAAGACATCACAGGAAGAGGTAGAGAAAGATGATAATGCCA
GAAAAGAGATGGAGGGTCTTAGGAAGGGTCAAAGACAGGAACTCAGAAAGGCGACTCTCT
AACTCGAGAAAGATAATCTTGAAGGAAGAAATGAAAAAGTCATTACCTACTTAAGGAAAA
CTCAGTTCCTATTGGATCAGACACCCTTTCAAACCTCCCCAAGACCTAGGACATCCAAGT
GTTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LMIYEPHFTYSLLEHVELPRSRERSLSPKSTSPPP--SPEVWAESRSPGTISQASAPRTTGTPRTPLPHFHHPETTRPDSNIYKKPPIYKQRESTAGSPQ
LMIY..H..YS.LEH.E...S.......KSTSP.P..SPEVW..SR..GTISQA.APR.TGTP...L.HF..P.....DS..YK...I.KQRES...S.Q
Retrocopy
LMIYKFHCPYSFLEHMERLGSQDLVFT-KSTSPSPLASPEVWVKSRTSGTISQALAPRITGTPQNTLAHF--PSSSYSDSHMYKQTQIHKQRESVDSSSQ


Parental protein
SKHLIEDLIIESSKFPAAQP-PDPNQPAKIETDYWPCPPSLAVVETEWRKRKASRRGAEEEEEEEDDDSGEEMKALRERQREELSKVT-SNLGKMILKEE
.K...EDL.I.SS..PAA.P.PD.N...KIE.DYW.C..SLA.VE.E..K.K.S.....EE.E..D.....EM..LR..QR.EL.K.T.SN..K.ILKEE
Retrocopy
HKPSSEDLVIKSSMLPAA*P/PDSNLLTKIEIDYWLCSLSLAIVEIERKKQKTS----QEEVEKDD-NARKEMEGLRKGQRQELRKAT\SNSRKIILKEE


Parental protein
MEKSLP-IRRKTRSLPDRTPFHTSLHAGTSKSS
M.KSLP...RKT..L.D.TPF.TS....TSK.S
Retrocopy
MKKSLP/YLRKTQFLLDQTPFQTSPRPRTSKCS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide