RetrogeneDB ID:
retro_mputfur_1219
Organism:
Location:
GL897045.1:621886-622523 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.02 %
Coverage:
50.24 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
VPS4B
Parental gene aliases:
No gene alias available
Parental gene description:
vacuolar protein sorting 4 homolog B (S. cerevisiae) [Source:HGNC Symbol;Acc:10895]

Genomic region (view in browser)





>retro_mputfur_1219
CTCCAGAAAGCAATAGATCTTGCTGGCAAAGCAGCTCAGGAAGACAAAGCCGGGAACTAT
GAGGAAGCGCTTCAACTCTACCAACATGCCGTTCAGTATTTTCTTCATGTAGTTAAATAT
GAAGCGCAGGGCGATAAAGCCAAGCGGAGTATCAGGGCAAAGTGTACAGAATATCTCGAT
AGAGCAGAAGAACTAAAGGAGTAGCTGAAAAAGAAAGAGAAAAATCCACAGAAACCAGTG
AAAGAGGGACAGCCGAGTCCAGCTGACGAGAAGGGGAATGACAGTGATGAGGAAGGAGAA
TCTCATGATCCTGAAAAAAAGAAACTACAGAATCAACTTCAAGGTGCCATTGTTATAGAG
CGACCAAATGTGAGATGGAGTGATGTTGCTGGCCTCGAAGGAGCCAAAGAGGCACTTAAA
GAGGCTGTGACACTGCCTATTAAATTCCCTCATCTTTTTACAGGCAAGAGAACACCTTGG
AGGGGAATTCTGTTATTTGGGCCACCTGGAACAGGAAAGTCCCATTTAGCCAAAGCTGTA
GCAACAGAAGCAAACAACTCAACATTTTTTTTCAATATCTTCCTCTGACCTTGTCTCTAA
GTGGCTAGGTGAAAGTGAAAGGCTAGTTATGGACATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LEKAIDLAGKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKKKEKNPQKPVKEGQPSPADEKGNDSDGEGE
L.KAIDLAGKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAK.SIRAKCTEYLDRAE.LKE.LKKKEKNPQKPVKEGQPSPADEKGNDSD.EGE
Retrocopy
LQKAIDLAGKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKRSIRAKCTEYLDRAEELKE*LKKKEKNPQKPVKEGQPSPADEKGNDSDEEGE


Parental protein
SDDPEKKKLQNQLQGAIVIERPNVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNST-FFSISSSDLVS
S.DPEKKKLQNQLQGAIVIERPNV.WSDVAGLEGAKEALKEAV.LPIKFPHLFTGKRTPWRGILLFGPPGTGKS.LAKAVATEANNST....ISSSDLVS
Retrocopy
SHDPEKKKLQNQLQGAIVIERPNVRWSDVAGLEGAKEALKEAVTLPIKFPHLFTGKRTPWRGILLFGPPGTGKSHLAKAVATEANNST\XXXISSSDLVS


Parental protein
KWLGESEKLVKNL
KWLGESE.LV...
Retrocopy
KWLGESERLVMDI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide