RetrogeneDB ID:
retro_mputfur_1224
Organism:
Location:
GL897045.1:4952165-4953054 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.83 %
Coverage:
82.78 %
Frameshifts:
4
Stop codons:
4


Parental gene:
Parental gene symbol:
AMZ2
Parental gene aliases:
No gene alias available
Parental gene description:
archaelysin family metallopeptidase 2 [Source:HGNC Symbol;Acc:28041]

Genomic region (view in browser)





>retro_mputfur_1224
ATGCAAATAGTAAGGCACTCTGAGCAGACACTAAACACAGCTCTCATCTCAAAAAACCCA
ACACTTGTGTCACAGCCTAAGTTAGATGCTGGCAAGCGGCAATTGCTGAATGAAGCCTTC
AAGCCAGACAATGACCTCTTTGGACCCATTAACTTGCATTCACAGTCAGATTGGTTCATC
TCTCATCCTGAGGCTCCCCAAGACTTTGAACAATTTTCAGTGATCCTTACGGAAAGGCAC
CCCCTCCAGAGAAATGCAGTATTTATATACAGTGCATTGGATTTCTAGGAAACATGAGAA
TTATCAGTGAGGAGTATACTAAATGGCTCAAGGGTGACTGTGAAGTATCCTTCTACGGCT
TGAAAGTAGAACTCCTAGAATTCATTCCTGTCTCTATCGGGAGGTGTTCCCTTAGAGTCA
ATGATAACACATAAAACCTTCATATTCAAGCAGGGCACATCCCCAAGTTCTTAAAAAAGA
AGAAACCTGGAGATGCTTTCTTTATTGTGGCAATAACAATGAATGACCTTACCCAAGAGA
CTCCTGGAATTTTGTCTTTGGACAGGCGTCTTTGGCAGGTGGTATGGGGATATTCAGCTT
TGCCGGGTATGGCAGTGACTGCTTATAGCTCACGCTAGGAAGACAAAGTAAACAAGCTGT
AGAAAGTATCTGCAAGTGACTATTCAGTTTTTGGTAACTATTATATTCCTGACGTGATGA
GTGTTCTGCTGTTTCACTCCTCTAAGACTTTAACCCGTGAGACTGGCACATATTTGAACT
TCAACCCTGCCAGTAGCTTGCATGCCTAATGCAAGACTCCAGCCACTTGGAAGAAGCTGA
CTGGCACCCCCTCAACCTGTGTCTTATCTGTTTACACAAGTTGCAGTGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQTVQHSEQTLKTALISKNPALVSQYEKLDDGERRLLNKAFKPDSDLFGPITLHSESDWIISHPEAPQDFEEF-FSDPSRKAPSPEKRSIYIQCIGSLGN
MQ.V.HSEQTL.TALISKNP.LVSQ..KLD.G.R.LLN.AFKPD.DLFGPI.LHS.SDW.ISHPEAPQDFE.F.FSDP..KAP.PEK.SIYIQCIG.LGN
Retrocopy
MQIVRHSEQTLNTALISKNPTLVSQ-PKLDAGKRQLLNEAFKPDNDLFGPINLHSQSDWFISHPEAPQDFEQF/FSDPYGKAPPPEKCSIYIQCIGFLGN


Parental protein
TRIISEEYIKWLKGYCEAFFYGLTVKLLEPVPVSVTRCSFRVNDNTQNLQIHAGHILRFLKKKKPRDAFCIVGITMIDL-YPRDSWNFVFGQASLTDGVG
.RIISEEY.KWLKG.CE..FYGL.V.LLE..PVS..RCS.RVNDNT.NL.I.AGHI..FLKKKKP.DAF.IV.ITM.DL.YPRDSWNFVFGQASL..G.G
Retrocopy
MRIISEEYTKWLKGDCEVSFYGLKVELLEFIPVSIGRCSLRVNDNT*NLHIQAGHIPKFLKKKKPGDAFFIVAITMNDL/YPRDSWNFVFGQASLAGGMG


Parental protein
IFSFARYGSD-FYSSHYEGKVNKLQIVSSSDYSIFDNYYIPEVTSILLLRSCKTLTHEIG-HIFGLRHCQWLACLMQGSNHLEEADRRPLNLCPICLRKL
IFSFA.YGSD..YSS..E.KVNKL..VS.SDYS.F.NYYIP.V.S.LL..S.KTLT.E.G.HIF.L..CQ.LACLMQ.S.HLEEAD..PLNLC.ICL.KL
Retrocopy
IFSFAGYGSD\AYSSR*EDKVNKL*KVSASDYSVFGNYYIPDVMSVLLFHSSKTLTRETG/HIFELQPCQ*LACLMQDSSHLEEADWHPLNLCLICLHKL


Parental protein
QC
QC
Retrocopy
QC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide