RetrogeneDB ID:
retro_mputfur_1231
Organism:
Location:
GL897048.1:489036-489884 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.82 %
Coverage:
78.75 %
Frameshifts:
4
Stop codons:
1


Parental gene:
Parental gene symbol:
PRR11
Parental gene aliases:
No gene alias available
Parental gene description:
proline rich 11 [Source:HGNC Symbol;Acc:25619]

Genomic region (view in browser)





>retro_mputfur_1231
AGAGTGTGGTCTATATACAACTGGTGCCAGAACTGCATGGCCCAGAATTCAGAAGTCTTG
AGAGACATCATCTCTCCATCCTATTATTGCCACCAAAAACTTAACAGTCTAAAACAACAG
TTTCACATTTTGGCAAGTGAATTCTGCAGACTCTGGGAGGCACTGAAGACCATCCTGGAG
GACTCGTCCTTGTCCAAGTTGTGGTCAAATGGGTCACACAAGTGGTAAATTTACAAATGT
GCCTGCCTGTGTTCTAACCATCCCTGGAGAATCCCCAGCTGGACTTCCTCCCATACTGCC
ACAGCCAGCTACCCACCTTCCTCCTCATCCATCTCTGCCTCCGCTCCCCCTGCCTCCTCT
CTGCCTGTACTCCATCACCTGTGGCACCTGGGCTGCTCAGAAATTCTGACTGTACTAAAG
AACATCAGAATGGACCATTAAAAACAAGATGGATCCATGCAGATAATAGTTAAAGATCTA
CTGTCTGAAATGAAAGAACACACGGTTTTGATGAAGAAATTTGTATCATCACCAGAGGCA
CAGCATTCACTAGTTACAGTCTCTGACCTGCGGTGTGTTATCCTGAAACCCAGCCCCAAA
TTGTTACCACTTGACTTCCGCATGTCTTAATTACTCCTGGTAAAAGCCAGATGGATCTGC
GGAAACTACTTAGAAAAGTCAATGTTAAGAGGATCACAGGGGGAGCCCCACTTACCAATA
AAGAAAATATGGAAACAGGAACTAGGCTGACTCCAGTGATGACCTCGAGGAGAAAGTTTC
AGCACAGTCAGCCTGGAAGTCCGACTCAAACCCTGCCACTTTCTACAAGCAGCTTTGTTG
AACAAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RVWSIYNWCQNCMAQSLEVLKDTIFPSRFCRRELHSLKERFCILESELCKLQETLKTVLENSS-CPSCGQTCHISGKLKNVPARVLNTPGESRAILPPTL
RVWSIYNWCQNCMAQ..EVL.D.I.PS..C...L.SLK..F.IL.SE.C.L.E.LKT.LE.SS.CPSCGQ..H.SGK..NVPA.VL..PGES.A.LPP.L
Retrocopy
RVWSIYNWCQNCMAQNSEVLRDIISPSYYCHQKLNSLKQQFHILASEFCRLWEALKTILEDSS\CPSCGQMGHTSGKFTNVPACVLTIPGESPAGLPPIL


Parental protein
PQPVTPTPALLPPPPPPPPPPPL-PPPPPPTAPVLLRKSDRTKALQAGPLK-RDGPMQITVKDLLTVKLKKTQCFDERKKLIPSPKAQNPLVTVSDLQRV
PQP.T..P....P..PP.P.PPL....P.P.AP.LLR.SD.TK..Q.GPLK..DG.MQI.VKDLL......T......KK...SP.AQ..LVTVSDL..V
Retrocopy
PQPATHLPP--HPSLPPLPLPPL\ACTPSPVAPGLLRNSDCTKEHQNGPLK\QDGSMQIIVKDLLSEMKEHTVLM---KKFVSSPEAQHSLVTVSDLRCV


Parental protein
TLKPNSKVL-STRVTNVLITPGKSQIDLRKLLRKVDVERSPGGTPLTNKENMDTGTGLTPVMTRALRRKFQMAHPRSPTQTLPLSTSSFDEQN
.LKP..K.L..T....VLITPGKSQ.DLRKLLRKV.V.R..GG.PLTNKENM.TGT.LTPVMT...RRKFQ...P.SPTQTLPLSTSSF.EQN
Retrocopy
ILKPSPKLL/TT*LPHVLITPGKSQMDLRKLLRKVNVKRITGGAPLTNKENMETGTRLTPVMTS--RRKFQHSQPGSPTQTLPLSTSSFVEQN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide