RetrogeneDB ID:
retro_mputfur_1232
Organism:
Location:
GL897048.1:4844174-4844666 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.76 %
Coverage:
97.67 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
TIMM17B
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of inner mitochondrial membrane 17 homolog B (yeast) [Source:HGNC Symbol;Acc:17310]

Genomic region (view in browser)





>retro_mputfur_1232
GTGGAGGAGAACACTCGGGAGCCTCGCCCCTGGTGAATGGTAGTGGATTGCCTTCCCTAT
GGATTCATTGGCAGTGGAATCTTCCAGGCCATCAAGGCCTTCCACAACGCCCCTGTCTAA
ATTTGCACCGACTGAGAGCTAGCGTCAACGCTGGGGGGATCCGAGCCCCCCGGACTGGAG
GTAGCTTTTCGGGGTGGGGGAGGCTGTTCTCCACCATCAACTGTGGCCTGGTGTGCCACA
GGGCAAAGAAGATCCCTGGAACTCCATCACAAGCTGAGAACTGACCGGGGCGGTGCTGGC
AGCCCGCAGTGGCCCAATGGCCATCGTAGACTCAGCATGATGGGGGGCCTCCTCTTGGCC
CTCCTAGAGGGTGTTGGTGTCCTCCTCACTCGCTACACTGCCCAGCAGTTCCACAATGCA
TCCTTGTTCCTGGAGGACCCCAGCCAGCTTCCGCTTAAGGAGGGTACCCCAGCCCTAGGC
TATCACCTCTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGI-RHRMRGSVNAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLR-GKEDPWNSITSGAL
.EE..REP.PW..V.DC......G.IG.G.FQAIK.F.NAPV.I..HR.R.SVNA..IRAP..GGSF..WG.LFSTI.CGLV..R.GKEDPWNSITS..L
Retrocopy
VEENTREPRPW*MVVDC---LPYGFIGSGIFQAIKAFHNAPV*I/LHRLRASVNAGGIRAPRTGGSFSGWGRLFSTINCGLVCHR/GKEDPWNSITS*EL


Parental protein
TGAVLAARSGPLAMVGSA-MMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKEGTPAPGYPSY
TGAVLAARSGP.A.V.SA.MMGG.LLAL.EGVG.LLTRYTAQQF.NA..FLEDPSQLP.KEGTPA.GY..Y
Retrocopy
TGAVLAARSGPMAIVDSA/MMGGLLLALLEGVGVLLTRYTAQQFHNASLFLEDPSQLPLKEGTPALGYHLY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide