RetrogeneDB ID:
retro_mputfur_1234
Organism:
Location:
GL897049.1:4018994-4019422 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.69 %
Coverage:
90.51 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
UBE2I
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2I [Source:HGNC Symbol;Acc:12485]

Genomic region (view in browser)





>retro_mputfur_1234
GCCTGGAGAAAGGACCACCATTTGGCTTGGTGGCTGTCCCAACAAAAAATCCTGGAAGCA
GGATGAACCTCATGACCTGAAAATATGCCATTCCAGGCAAGGAAGAGACACCATGGGAAA
GAGACTTGTTTAGACTGTGGATGCTTTTCAGGGACCACTATCCATCCTCACCCCCAAAAT
GCCAATTTTAGCCACTACTGTTTCACCCAAATATGTACCCATTGGGCACAGTGGGCCTGT
CCATCCTTGAGGAGGAAAGGGACTGGAGGCCAGCCATCACAATTAAGCAGATCTTGTTAG
GAATACAGGAACTTTTAAATTAACCAAATATCCAGGACTCAGCCCAAACAGAGGCTCACA
CAATTTACGGCCAAAACAAAGTGGGCTACAAGAAGAGGGTTTGAGCACAAGCCAAGAAAT
TCACACCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AWRKDH-PFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQIL
AWRKDH.PFG.VAVPTKNP...MNLM....AIPGK..TPWE..LF.L.MLF.D.YPSSPPKC.F.P.LFHPN.YP.GTV.LSILEE..DWRPAITIKQIL
Retrocopy
AWRKDH/PFGLVAVPTKNPGSRMNLMT*KYAIPGKEETPWERDLFRLWMLFRDHYPSSPPKCQF*PLLFHPNMYPLGTVGLSILEEERDWRPAITIKQIL


Parental protein
LGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP
LGIQELLN.PNIQD.AQ.EA.TIY.QN.V.Y.KRV.AQAKKF.P
Retrocopy
LGIQELLN*PNIQDSAQTEAHTIYGQNKVGYKKRV*AQAKKFTP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide