RetrogeneDB ID:
retro_mputfur_1240
Organism:
Location:
GL897051.1:1453752-1454531 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.0 %
Coverage:
100.0 %
Frameshifts:
4
Stop codons:
5


Parental gene:
Parental gene symbol:
MAPRE1
Parental gene aliases:
No gene alias available
Parental gene description:
microtubule-associated protein, RP/EB family, member 1 [Source:HGNC Symbol;Acc:6890]

Genomic region (view in browser)





>retro_mputfur_1240
ATGTCAGTGAACATATACTCAACATCAGTCACCAGTGATAACCTAAGTCTATATGACATG
CTGGCCTGGATCAATGAATCTCTGTAACTGAATCTGATGAATATCGTATAGTTGTGCTCA
GGGGCTGTCCATTGTCAGTTTATGGACATGCTGTTCTATTGCTTCATTGCCTTGAAGAAA
GTGAAATTCCAGGATGAGCCAGAACATGAATATATCCAGAACTTCAAAATACAAGCAGGT
TTTAAGAGAATGGATGTTGACAAAATAATTCCTGGGACAAATTAGTGAAAGTAAAGTTTC
AGGACAATTATGAATTTGTTCAGTGATTCAAGAAGTTTATTGATGCAAACTATGATGAAA
AAGATTATGACCTTGCCAGACAAGGTCAAGAAACCACAGTGGCTCCCGCCCTTGTTGCTC
CAGCTCTGAACAAACTGAAGAAACCTTTCAGCTCTTGCAGTGAGCTCCCCAGAGGCCCAT
TGCAACACACAGAACCACTGCAACCCCTAAGGCTAGCCCAGATGTGGCACAAGAGAATCC
TGGTGTGGGCAACGGGGATGATGAAGCAGCTGAATCAACGCAGCAGGTCAACATATTGAA
ACATACCATCAAGACTTGGAGAAAGAAAGGGATTTCTACTTTGAGAAGCTAAGGAACATT
GAATTGATTTGCCTGGAAAACAACCCTGTATTTCAGAGGACTGTGGGCATTCTCTATGCC
ATTAATGAAGTCTTTTTGGTACCTGATTAAGGGGCCCATAGGAGGAACGAGAAAAGTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIP-VDKLVKG
M.VN.YSTSVTSDNLS..DMLAWINESL.LNL..I..LCSGA..CQFMDMLF...IALKKVKFQ...EHEYIQNFKI.QAGFKRM.VDKIIP..DKLVK.
Retrocopy
MSVNIYSTSVTSDNLSLYDMLAWINESL*LNLMNIV*LCSGAVHCQFMDMLFYCFIALKKVKFQDEPEHEYIQNFKI-QAGFKRMDVDKIIP/WDKLVKV


Parental protein
KFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLSSSSA-APQRPIATHRTTATPKTGPGVVRKNPGVGNGDDEAAELMQ
KFQDN.EFVQ.FKKF.DANYD.KDYD...ARQGQET.VAP.LVAPALNK.KKP.SS.S..APQRPIATHRTTATPK..P.V...NPGVGNGDDEAAE..Q
Retrocopy
KFQDNYEFVQ*FKKFIDANYDEKDYD--LARQGQETTVAPALVAPALNKLKKPFSSCSE/APQRPIATHRTTATPKASPDVAQENPGVGNGDDEAAESTQ


Parental protein
QVNVLKLTV-EDLEKERDFYFGKLRNIELICQENEGENNPVLQRIVDILYATDEGFVIPDEG-GPQEEQEEY
QVN.LK.T...DLEKERDFYF.KLRNIELIC.EN....NPV.QR.V.ILYA..E.F..PD.G.GP.EE.E.Y
Retrocopy
QVNILKHTI/QDLEKERDFYFEKLRNIELICLEN----NPVFQRTVGILYAINEVFLVPD*G/GP*EEREKY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide