RetrogeneDB ID:
retro_mputfur_1242
Organism:
Location:
GL897051.1:4929832-4930186 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.98 %
Coverage:
96.72 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_1242
GCATTCAGAATGGTCCAGTGTTTGACCTACTGTCATAGTCTGTCCTACAATACAGCCTCT
AACAAAACAAGGCTGTCCCGGACGCCGGGTAATAGAATTGTTTACCTTTATACCAAGAAG
GTTGAGAAAGCACCAAAATCTGCATGTGGCATGTGCCCAGGCTGACTTCGAGGAGTTCGT
GCTGTGAGACCTAAAGTTCTTATGAGGTTGTCTAAAATGAAAAAACATGTCAGCAAGGTC
TTTAGTGGTTCCATGTGTGCTAAGTGTGTTCGTGACAGGATCAAGCATGCTTTCCTTATC
GAGGAGCAGAAAATCGTTGTGAAAGTGTTGAAGGCACAAGCGCAGAGTCAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AFRMVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLI
AFRMVQ.LTY...LSYNTASNKTRLSRTPGNRIVYLYTKKV.KAPKSACG.CPG.LRGVRAVRPKVLMRLSK.KKHVS....GSMCAKCVRDRIK.AFLI
Retrocopy
AFRMVQCLTYCHSLSYNTASNKTRLSRTPGNRIVYLYTKKVEKAPKSACGMCPG*LRGVRAVRPKVLMRLSKMKKHVSKVFSGSMCAKCVRDRIKHAFLI


Parental protein
EEQKIVVKVLKAQAQSQK
EEQKIVVKVLKAQAQSQK
Retrocopy
EEQKIVVKVLKAQAQSQK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide