RetrogeneDB ID:
retro_mputfur_1250
Organism:
Location:
GL897054.1:3243420-3243739 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.11 %
Coverage:
66.46 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
TMEM138
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 138 [Source:HGNC Symbol;Acc:26944]

Genomic region (view in browser)





>retro_mputfur_1250
GTTAATTCCTTCCTAGAACTACTCTGAATGGCTCTTGTCATCCTGGTGATTGCTGTTATC
CGGGATACCGTGATTCTCTGCAACATCAGCACCATTTTCCTCCTGTTCTTCAACATCTTC
CTCTTCCAGGCTGGCCTGGGCAACTCTGTATTCCAGAAGTTCAAAGGGATCGCCCTCCTC
ACAGTTGTGTTATTTGCCCCCAGCATCTTCCTTCATGCCTGGGTCATGACTTAACACTGG
AAAAACTCCCAATTGCTTTGTCAGGAGAGAGGGACTTCAAACTCCGTTTGTATTCCGGAG
ACTAGCACAGCGGTGTTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VNSFSELLRTAPVIQLVLFIIQDIAILFNIIIIFLMFFNTFVFQAGLVNLLFHKFKGTIILTAVYFALSISLHVWVMNLRWKNS-NRFVWTDGLQTLFVF
VNSF.ELL..A.VI.LV...I.D..IL.NI..IFL.FFN.F.FQAGL.N..F.KFKG...LT.V.FA.SI.LH.WVM...WKNS.N.FV...GLQT.FVF
Retrocopy
VNSFLELL*MALVI-LVIAVIRDTVILCNISTIFLLFFNIFLFQAGLGNSVFQKFKGIALLTVVLFAPSIFLHAWVMT*HWKNS\NCFVRREGLQTPFVF


Parental protein
QRLAAVLY
.RLA...Y
Retrocopy
RRLAQRCY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide