RetrogeneDB ID:
retro_mputfur_1252
Organism:
Location:
GL897055.1:3019051-3019663 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.67 %
Coverage:
99.51 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1252
ATGGGTGCTTACAAGTACATCCAGGAGCTATGGAGGAAAAAGAAGTATTACATAATGTCT
TTTGCTTTCAGGTTGTACCACTGTTGGTCCTGCTAGCTCTCTGAGCTCCACAGGGCCTCC
TCACCCCACTCAATCCACCAAACTGCCCAATAAAGTGCGTAAACTATGGCATAAGGCCAA
CCAAGGTTATGCCATATATCGGATTCGTGTGTGACACGGTGGCAACAAACACCCAGATCC
TAAGGGTGCTACCTATGCCAAGCTTGGTGTTAACCAGCTAAAGTTTGCCCAAAGCCTTCA
GTCTGTTGCAGATGAGAGAGCTGGACACCACCCTGGGGCTCTGAGAGTCTTGAACACTTA
CTGGGCTGGCAAAGATTCCACATCCAAATTCTTCCAGGTTATCCTCCTTGATCCATTCTA
TAAAGCTATCAGAAGAAATTCTGACACCCAGTGGATCACCTAACCAGTCCATAAGCACAG
GGAGATCTGAGGGTTGGCATCAGCAGGCTCAAGAGCCCTAGCCATGGAAAGGGTCACAAG
TTCTACCACACTATTGGCTGTTCTTGCCTCCCAATATGGAGAAGACACAATCCTCTCCAA
GTCCACCATTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGAYKYIQELWRKKQSDVMRFLLRV-RCWQYRQLSALHRA-PRPTR----PDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKF
MGAYKYIQELWRKK....M.F..R...CW....LS.LHRA.P.PT.....P.K.R.L..KA.QGY.IYRIRV..GG.K.P.PKGATY.K....GVNQLKF
Retrocopy
MGAYKYIQELWRKKKYYIMSFAFRLYHCWSC*-LSELHRA\PHPTQSTKLPNKVRKLWHKANQGYAIYRIRV*HGGNKHPDPKGATYAKL---GVNQLKF


Parental protein
ARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGR-KSRGLGKGHKFHHTIGGSRRAAWR
A.SLQSVA.ERAG.H.GALRVLN.YW.G.DST.KFF.VIL.DPF.KAIRRN.DTQWIT.PVHKHRE..GL.SAG..KS...GKGHKF.HTIG.S....WR
Retrocopy
AQSLQSVADERAGHHPGALRVLNTYWAGKDSTSKFFQVILLDPFYKAIRRNSDTQWIT*PVHKHREI*GLASAGS/KSPSHGKGHKFYHTIGCSCLPIWR


Parental protein
RRNTLQLHRY
R.N.LQ.H.Y
Retrocopy
RHNPLQVHHY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide