RetrogeneDB ID:
retro_mputfur_1253
Organism:
Location:
GL897055.1:4296703-4297263 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
84.66 %
Coverage:
63.09 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
MMADHC
Parental gene aliases:
No gene alias available
Parental gene description:
methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria [Source:HGNC Symbol;Acc:25221]

Genomic region (view in browser)





>retro_mputfur_1253
AGACACGAGTTTGTGATGGCACAGTATGTGAATGAATTTCACAGTAATAATGCACCTGAA
CAAGAAATCAGCAGTGCAGAAACTTACTTTGAAAATGCCAAAATAGAGTGTGCAATCCAG
ACATGTCCAGAATTGCTGCAAAGAGATTTTGAGTCACTGTTTCCAGAAGGAGCTACCAAC
AAACTAATGATTCTGACTATAACACAGAAAACTAAGAATGATAAGACTTTTTGGAGCAAA
GAGGCAGAAAATGAAAGAGAAATGCTTTTAGAAAAGTTCATTAATGGTGCTAAGAAAATT
TGCTATGCTCTTCGAGCTGAAAGGTATTGTACTGACTTAACTGACCCATCATCTGGTTAG
TATATTTTGGAACACAGACCAACAACATTCTTTTTGAGACAGATGAACACTATTGACATT
TAGGATTCTCTGTGGATGATCTTGGCTGCTGTAAAGTGATTCATCATAGGCTCTGGGGTA
CCCATGTGGTTGTAGGAAGTATCTTCACTAATGCAACACTAGACAGCCATTTTATGAAGA
AATTAGGTGGAAACTAACAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RHEFVMAQYVNEFQGSNAPVEQEISSAETYFENAKVECAIQTCPELLRRDFESLFPEGATNKLMILTITQKTKNDMTVWSEEVENEREMLLEKFINGAKE
RHEFVMAQYVNEF...NAP.EQEISSAETYFENAK.ECAIQTCPELL.RDFESLFPEGATNKLMILTITQKTKND.T.WS.E.ENEREMLLEKFINGAK.
Retrocopy
RHEFVMAQYVNEFHSNNAP-EQEISSAETYFENAKIECAIQTCPELLQRDFESLFPEGATNKLMILTITQKTKNDKTFWSKEAENEREMLLEKFINGAKK


Parental protein
ICYALRAEGYWADFIDPSSG-LAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVIRHRLWGTHVVVGSIFTNATPDSHIIKKLGGNYQ
ICYALRAE.Y..D..DPSSG.L..FG..TNN.LFETDE.Y.HLGFSVDDLGCCKVI.HRLWGTHVVVGSIFTNAT.DSH..KKLGGN.Q
Retrocopy
ICYALRAERYCTDLTDPSSG/LVYFGTQTNNILFETDEHY*HLGFSVDDLGCCKVIHHRLWGTHVVVGSIFTNATLDSHFMKKLGGN*Q


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide