RetrogeneDB ID:
retro_mputfur_1254
Organism:
Location:
GL897056.1:1149610-1149964 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.11 %
Coverage:
83.8 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
TOMM22
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of outer mitochondrial membrane 22 homolog (yeast) [Source:HGNC Symbol;Acc:18002]

Genomic region (view in browser)





>retro_mputfur_1254
GCTGCTGCCACCACTAGTGGCCTTGGGTTGCCCCTGTTCCAGTATGAATGCTTCTGAAAG
GCAATGCTAGGAATTCTGAGGAGGACCTGGAGGAGGAAGAAGGAAGGAGCTAAAATATAT
TCTGTTGAAGAGACTGTAGGGTCTGACAGAGATGTTCCTAGAGTGGGTCTGGTCCACAGC
TAGAGCCATTTTTGATCTTTCCCTCTTTGTAGCTCAAAAAATGTACAGGTTTTCCAGGGC
AGCTTTGTCAACTGGGACCACTTTCCTTCAGATACTGTTTCTTCCTGCTGTCTTTGAGAC
TGAGAAGTTTCAATGGAGCAGCAGCAACAACTGTATCAAGAGCAGATGCTCCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAAAAGGPGAPLSPDE-LLPKGDSEKTEEELEEEDD-EELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV
AAA...G.G.PL...E..L.KG.....EE.LEEE....EL...L..RL.GLTEMF.E.V.S.A.A.FDLSLFVAQKMYRFSRAAL..GTT...IL.LP.V
Retrocopy
AAATTSGLGLPLFQYE/MLLKGNARNSEEDLEEEEG/KELKYILLKRL*GLTEMFLEWVWSTARAIFDLSLFVAQKMYRFSRAALSTGTTFLQILFLPAV


Parental protein
FETEKLQ-MEQQQQLQQRQILL
FETEK.Q.MEQQQQL.Q.Q.LL
Retrocopy
FETEKFQ/MEQQQQLYQEQMLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide