RetrogeneDB ID:
retro_mputfur_1257
Organism:
Location:
GL897057.1:209179-209521 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
56.78 %
Coverage:
60.21 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
NDUFA12
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 [Source:HGNC Symbol;Acc:23987]

Genomic region (view in browser)





>retro_mputfur_1257
TTCAGGGAAAACAGTATGAGGGCTGGTACCTGAGTGGGAGAAGACAAATATGGAAACAAA
TACTAGGAAGACAACAAGTGGCTTTGGCTGTCACCAATGGGTTATATACACTACTGAAAT
GAATGGCAGAAACACCTTTCAGGGATGTGGATGGAAGCACGATGCCCCCCGAACAGCATC
ACCGGCTTCAGTCTCTGAGATGACCCTCCAACAACAAAACCACTTATTGCTGGTAAACTC
TTCTGCACAAGCCGCGGGGTCAGTGTGAGTGGCCCTTCAGAACAGTAGGCACCTTGCTCT
ACCTCTGGAAAGAGGACTCACGAGTGGGTCCCACCTTCAACA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FRANDVRVGTLVGEDKYGNKYYEDNKQF-FGRHRWVIYTTEMNGKNTFW-DVDGSMVPPEWHRWLHCM-TDDPPTTKPPVARKFIWTNHKFNVSGTPEQY
FR.N..R.GT.VGEDKYGNK.Y.......FG.H.WVIYTTEMNG.NTF..DVDGS..PPE.H..L.....D.P.TTKP..A.K...T.....VSG..EQ.
Retrocopy
FRENSMRAGT*VGEDKYGNK-Y*EDNKW\FGCHQWVIYTTEMNGRNTFQ\DVDGSTMPPEQHHRLQSL\DDPP-TTKPLIAGKLFCTSRGVSVSGPSEQ*


Parental protein
VPYSTTRKKIQEWVPPST
.P.ST..K...EWVPPST
Retrocopy
APCSTSGKRTHEWVPPST


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide