RetrogeneDB ID:
retro_mputfur_1258
Organism:
Location:
GL897058.1:1379050-1379925 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.66 %
Coverage:
96.05 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
KATNBL1
Parental gene aliases:
No gene alias available
Parental gene description:
katanin p80 subunit B-like 1 [Source:HGNC Symbol;Acc:26199]

Genomic region (view in browser)





>retro_mputfur_1258
TTTTGTAATAATATTGAGGCTCATTCCACTGATCTTCCTAGAAAAGGGATCTCAAATTTT
ACTAATAAGAGCATGAAGGAGGTTAGGAAAGCTCCCAAACTGTTGACTGCTTACGTAAAA
AAAACAGTTGGACAAGCTGTGGAAAACCCAGATATACTACATCAGGGATCTACCACAGAA
AGAAAGTGCATCGTCCTTTTCCAAATTCTGGTTGCAGGGAAAAATCAGTCCCCTACAAGT
GGGGACTGTGACATGGCAAATAAAGAAAATCAACTGACTTGTGTAGCCCACCTGCCTGTA
AAGGTACGCCATGATCGTCGAACATATTTGGTTAACTCCAGTGATTCTGGTTCTTCACAG
TCAGAAAGCCCATCATCAAAACATAGTGGGCTTTTTTCTGAGGTTTCTGAAGACCATAAA
ACAATGGCACAGGTTTTGTTCAGCAGGTATTTGAGATTGAATGTAGCTGTAACATTCTGG
AGAAAGAGGAATAGAAGTGAACTTGTAGTTTATTGGGTGAGATAGAAGACCTTGGAGCTG
TTGTGGACTGCCTTCCTGTGTTCACCAATAGTTTACAGGAAGAAAAACAATACATCTCAC
TTGGCTGCTGTGCAGATTTGCTACCTTTAGGGAAGTTCCTACTTAAAAGCAAATTTGAAG
AATATATAATAGTTGGTTTAAACCAGCTTCAAGCAGTCATAAAAAGGTGGTAGTCAGAAC
TATCATCCAAAACAGAAATTATACATGATGGAAATATTCAGATTGTAAAACAACAGTTAA
AGGGATTATGGGAACAGGAAAACCATCTTACTTTGGTTCCAGCATATACTAGTAATATCG
CCAAGGATGTAAGTGCTTATTTATTACAGTTGCAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FCNNIEDHSTDLPRKRISNFTNKNMKEVKKSPKQLAAYINRTVGQAVKSPDKLRKV-IYRRKKVHHPFPNPCYRKK-QSPRSGGCDMANKENELACAGHL
FCNNIE.HSTDLPRK.ISNFTNK.MKEV.K.PK.L.AY....VGQAV..PD.L....IY.RKKVH.PFPN...R.K.QSP.SG.CDMANKEN.L.C..HL
Retrocopy
FCNNIEAHSTDLPRKGISNFTNKSMKEVRKAPKLLTAYXXXXVGQAVENPDILHQG/IYHRKKVHRPFPNSGCREK\QSPTSGDCDMANKENQLTCVAHL


Parental protein
PEKLRHDSRTYLINSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVALTFWRKRSISELVAYLVR-IEDLGVVVDCLPVLTNSLQEEKQ
P.K.RHD.RTYL.NSSDSGSSQ.ESPSSK.SG.FSEVS.DH.TMAQVLFSR.LRLNVA.TFWRKR..SELV.Y.VR.IEDLG.VVDCLPV.TNSLQEEKQ
Retrocopy
PVKVRHDRRTYLVNSSDSGSSQSESPSSKHSGLFSEVSEDHKTMAQVLFSRYLRLNVAVTFWRKRNRSELVVYWVR/IEDLGAVVDCLPVFTNSLQEEKQ


Parental protein
YISLGCCVDLLPLVKSLLKSKFEEYIIVGLNWLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQENHLTLVPGYTGNIAKDVDAYLLQLH
YISLGCC.DLLPL.K.LLKSKFEEYIIVGLN.LQAVIKRW.SELSSKTEII.DGNIQI.KQQL.GLWEQENHLTLVP.YT.NIAKDV.AYLLQLH
Retrocopy
YISLGCCADLLPLGKFLLKSKFEEYIIVGLNQLQAVIKRW*SELSSKTEIIHDGNIQIVKQQLKGLWEQENHLTLVPAYTSNIAKDVSAYLLQLH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide