RetrogeneDB ID:
retro_mputfur_1269
Organism:
Location:
GL897064.1:565215-565769 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.42 %
Coverage:
91.22 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
PPP1R2
Parental gene aliases:
No gene alias available
Parental gene description:
protein phosphatase 1, regulatory (inhibitor) subunit 2 [Source:HGNC Symbol;Acc:9288]

Genomic region (view in browser)





>retro_mputfur_1269
GCCTCACATCGGCCCATCGAGGGGGTCCTGAGGAGCATGAGCTCTGCAACTTCTTCTCGA
GAGGCCTTGGCCAAGCAGCTCAGCAAGAGAGTCCACAAAGAACTGGGGAAAAAATCCCAG
AAGTGGGATGAAGTGAACATTCTGGCCACCTATCACCCAGACGACAAAGACAATGATTTG
ACGAGAATAGAAGAACCCGGCCCTCCTCACCATAGTATGGTGTGATGGTGAAGATGGGTG
CAGTGGTTTGGAAACCACTGCTGCCCTGACCCCGGATTCCTTCCCTAAGAAATCAGCTGC
TGCTGAACACTCTCAGCCAAAGTATGGGGTTCACGAATAAGAAAGCAGTGCAGACAAGAG
AGACCTCTCACCTGAAGAACAAGGAGAAAAGCAACAATTTGAAATGAAAAGGGAGTGTCA
CTTCAATGAAGGACTGACTATTAAATTCGCTGGACAAATAATTTTCAAGGACTACATGAG
GAGGAGGAAAATGAGGACTGTCAGAGATAGCTGCTAAAGAAAGCATGGAGACCAGGATCT
ACTGCAGAGGGGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASHRPIKGILKNKSSTTSSVVASAEQPGRSVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMVG-DDEDALSDSETNEALTPDILAKKL
ASHRPI.G.L...SS.TSS..A.A.Q....V..EL.KKSQKWDE.NILATYHP.DKD..L..I.EP..P.H.....D.ED..S..ET..ALTPD...KK.
Retrocopy
ASHRPIEGVLRSMSSATSSREALAKQLSKRVHKELGKKSQKWDEVNILATYHPDDKDNDLTRIEEPG-PPHHSMV\DGEDGCSGLETTAALTPDSFPKKS


Parental protein
AAAEGSEPKYRVHEQASSEDEDSDLSPEEQEKKRQFEMKRKLHYNEGLNIKLARQLISKD-LHDDEEDEE-MSETAAEESMNTEELNQGS
AAAE.S.PKY.VHE..SS.D...DLSPEEQ..K.QFEMKR..H.NEGL.IK.A.Q.I.KD.LH..EE.E...SE.AA.ESM.T.....G.
Retrocopy
AAAEHSQPKYGVHE*ESSADK-RDLSPEEQGEKQQFEMKRECHFNEGLTIKFAGQIIFKD/LHEEEENED/LSEIAAKESMETRIYCRGA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide