RetrogeneDB ID:
retro_mputfur_1270
Organism:
Location:
GL897064.1:1047005-1048472 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.45 %
Coverage:
72.46 %
Frameshifts:
8
Stop codons:
1


Parental gene:
Parental gene symbol:
CKAP2
Parental gene aliases:
No gene alias available
Parental gene description:
cytoskeleton associated protein 2 [Source:HGNC Symbol;Acc:1990]

Genomic region (view in browser)





>retro_mputfur_1270
CCAGCCGTGCCTCAGGAGCTACACTACCCCCAACTAGAGGGCTCAGCCTGCATTCAGAGA
ACAAAGGAGACAAAAACTCAGGGAACATATATTAAAAAGAAAAGCTTTTTTTGCATACAG
ACAGGAAGATTACATACCCAGTAGTAGAGACCATGAAGTGATGAACTCTGAGGGCCAGGT
CTGCAAAGAGACAAAAGTTCTGAAATTTAAAACAAAAATGGCTGGTAAAGAAAATGTCAG
TAGACCTCCTGGGAACAAAAATCATATAACAATGAGAAAAAATTGTATTCCTTTAAGACC
TTCTAATGAATCAACCAATTCAACCATAGTGATTGACACTACATAATTTTGAGGATAATA
ATCAAATGGGACAATCCATACCAATTAAAGATGACCCTCAACATCAACACATGAATTAAG
CCAAGTGTTTCATTTTAAAAGCAACAATAAAAAGGAACAAATACCCAAAGAAAAACCAAA
GATGCTAACATGCCCAAGGAGTTTGTGCTTGGGTCTTACCCTGGCCAAATTGTTCAGTCT
AAGATTAATTCATTTAGAAAGCCCCTGCTAGTAAGAGATGAGAGTTCGGCAACAACGAAG
AAACCTTCAGCTGCTGTCCCTAAAGCCCCAGAGCCTCCACCCACAGACACCCACAGTGTG
ACCATGAAAAGTGATAGAGCCACAAACGCGGTGACCATTGCTAAACTTGGGAGCACGGCA
TCTCAGGATAGACAGCTGGTGTGGCCTCCCATCAGAAGTCACAGTGACAGTGCTCAGGGT
GCTGTGAAACAGGGCCTTGGGAGAACCACCGCCAACATTATAATCTGGGAAGGGCTCGGG
AGGATGAATTACTGCAATCAAACACGGTTTCATCTAGTGCCAAAACCGGTTCTCAGGATG
TAGAGAGAAGGAAGACACTGTCAATAAGCCTGACCTCTGAAACTCTAGGCAAGCCTGCTG
CATCTTCTAAGACCAAACTGATACTGAAATCAAAAAGCACTGACCCTTGTAGACACATAT
AGCAAAAGCAACTCTTGATAGATAGGCTCAGGCCAGAGAAACAGCAGAAGAGAGAAAAGC
TCGTCTGAGTGAGTGGAAAGCTGGCAAAAGAAAAGTGCTGAAAATGCCTCCTAGCTCAGT
GATTACCCAGCCTGAGCCTGAAGGGCAGAATGAAAACTCAGCTGGGTCCTTTTGGACAAT
CATGGCAGAAGATGAGCAAAGATTATTTACTGAAAAAGTAAACAAGACATTTTTGGAATG
CCTAAACCTGATTAATGAGAGATGCCAGAAGAAGAAATGTTGGTCATACTGAATGACCTC
ATTAAAAATATTCCAGATGCCAAAAAACTTGTTAAATATTGGCTATGCTTTGCACATATT
GAACCACTCACAAGTCCTATCGAAAATATTATCACAATGTCTGAGAAAGCTGTTCTGGCA
GGGGCTCAGACTATTGAAGAAATGCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PAVPQDLQ-LPPSQ-RAQPAFREQRRQKLKEHILKRKTFFAYKQENHIPS-RDQKVMNSEGQVHEETKVLKFETKMAGKENVSRPPGNKNHTTTGKNCSP
PAVPQ.L..LPP...RAQPAFREQRRQKL.EHILKRK.FFAY.QE..IPS.RD..VMNSEGQV..ETKVLKF.TKMAGKENVSRPPGNKNH.T..KNC.P
Retrocopy
PAVPQELH/LPPTR/RAQPAFREQRRQKLREHILKRKAFFAYRQEDYIPSSRDHEVMNSEGQVCKETKVLKFKTKMAGKENVSRPPGNKNHITMRKNCIP


Parental protein
LRPSNKSTNSTIATDT-HNFEDNNQMRQSVPIKDDPQSQHMT-LSQVFHLKNNNKKKQ-VSTEKPKQDANTSKKLVLGSYRGQIVQSKINSFRKPLPVRD
LRPSN.STNSTI..DT.HNFEDNNQM.QS.PIKDDPQ.QHM..LSQVFH.K.NN.KK....T.....DAN..K..VLGSY.GQIVQSKINSFRKPL.VRD
Retrocopy
LRPSNESTNSTIVIDT\HNFEDNNQMGQSIPIKDDPQHQHMN/LSQVFHFKSNN-KKE/TNTQRKTKDANMPKEFVLGSYPGQIVQSKINSFRKPLLVRD


Parental protein
ESSATTKKPSAAVPKAPEPLPADTQGATVRSDRALNTVTTTKFGSTASQDRQLGRPPIRSHRDSAQDAVKQGLGRTTANVTIRKG-PREKELLHSNTVSS
ESSATTKKPSAAVPKAPEP.P.DT...T..SDRA.N.VT..K.GSTASQDRQL..PPIRSH.DSAQ.AVKQGLGRTTAN..I..G..RE.ELL.SNTVSS
Retrocopy
ESSATTKKPSAAVPKAPEPPPTDTHSVTMKSDRATNAVTIAKLGSTASQDRQLVWPPIRSHSDSAQGAVKQGLGRTTANIIIWEG/AREDELLQSNTVSS


Parental protein
SAKTGAQDVERRKTLARSLTSETVARPALSSNTKLVQKSKSIDPRRHT-IAKATLDRSARPKETAEERKARLSEWRAGKRKVLKRPPSAVVTQPEPGGQN
SAKTG.QDVERRKTL..SLTSET...PA.SS.TKL..KSKS.DP.RH..IAKATLDR.A...ETAEERKARLSEW.AGKRKVLK.PPS.V.TQPEP.GQN
Retrocopy
SAKTGSQDVERRKTLSISLTSETLGKPAASSKTKLILKSKSTDPCRHI/IAKATLDR*AQARETAEERKARLSEWKAGKRKVLKMPPSSVITQPEPEGQN


Parental protein
ENSVGSFWTTMVEEDEQRLFTEKVNKTFSECLNLINEGC-PKEEILVILNDLIKNIPDAKKLVKYWICLVRIEPLTSPIENIITIYEKAILAGAQPIEEM
ENS.GSFWT.M..EDEQRLFTEKVNKTF.ECLNLINE.C.P.EE.LVILNDLIKNIPDAKKLVKYW.C...IEPLTSPIENIIT..EKA.LAGAQ.IEEM
Retrocopy
ENSAGSFWTIMA-EDEQRLFTEKVNKTFLECLNLINERC/PEEEMLVILNDLIKNIPDAKKLVKYWLCFAHIEPLTSPIENIITMSEKAVLAGAQTIEEM


Parental protein
R
.
Retrocopy
Q


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide