RetrogeneDB ID:
retro_mputfur_1271
Organism:
Location:
GL897064.1:2415707-2416671 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
61.26 %
Coverage:
63.73 %
Frameshifts:
8
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1271
ATGACCATCCGGGTCACCTAGAAGTCCTACAAGATATTTGCCTCCAGCCCCGAAGCCTTC
AGTAGCTGCTCCTTCATGAGAGTGCCAGGTGCACGCATCAGCTCTTCCACCTTCTTCTAG
GTGGGCAGCAGCTTCTGGGTGGCCTGAGAAGCAGCATGAGGTGGTTGGAGGCTATGACAG
GGCCGGGGGTATGAGAGGAATCGTTGTCTCATTGAACCAGAGCCTGCTGAGCCCCCTCAA
GCTGGAAGTGAACCTGAATATCCAGGCTATGCACATCCAGGAGAAGAAGCAGATCAAGAC
TCTCAACCACAAGTTTGCCTCCTTCCAGCAACAAGCTGCAGCACTTGGAGCAGGAGAAAA
AATCCTGGAGTCCAAGTGGAGCCTCCTGCAGCAGCAGAAAAATGCTCGGAGTAACATGGA
CAGCGTGTTCAAGAGTTACATCAACAACCCCCGGGACAGCCGGACACACGGTAGGCAAGG
AGGAGCTGAAGCTGAAGGTGGAACATGACAACATGTGGGGGCCAGTGGGGGCTTCAAGAA
TAAAAATGAGGAAGAGATCAAAGAGTATGAAGATATGGGGAATAAATTTGTCTTCATCAA
GGATAGGAACGAAGTTGACGTGAACATGATGGAGCTGGAGTGCCTCATGGGAAGGGCTGA
CCCATGAGATCATCTTTTTAAGGCAGCTCTATGGAGAGGGGCTCCGGGACCTGTGGTACC
AGATCACAGACATGCCCCTCGTGCTGTCTATAGACAATAGCCGCTCCCTGGACCTGGATG
GCATTATCGCTGAGGTCAAGAACCACTGTGAGGAACACAGCAACCACAGCTGGCCTGAGG
CCAAGACCTTGTATCAGATCAAGTACAAGGCGCTGTTGGCATTGACTGGGAAGCACAGGG
ATGACTTCTGTACATGAAGATGGAGACTTCTTAGATGAACAGGAACATCAGCTGACATCA
GGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSVRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSAFSRVGGSF-RGGLNSSM-SVVGGYGGGAGGMGGITAVSVNQSLLSPLKLEVDPNIQAVRTQEK
M..RVT.KSYK...S.P.AFSS.S....PG.RISSS.F..VG.SF..GGL.SSM..VVGGY...AGGM.GI..VS.NQSLLSPLKLEV..NIQA...QEK
Retrocopy
MTIRVT*KSYKIFASSPEAFSSCSFMRVPGARISSSTFF*VGSSF/LGGLRSSM/EVVGGYDR-AGGMRGIV-VSLNQSLLSPLKLEVNLNIQAMHIQEK


Parental protein
EQIKTLNNKFASF-IDKVRHLEQQ-NKVLETKWSLLQQQKTARSNIDNMFESYISNLRRQL-DTLGQEKLKLEVELGNMQGLV-EDFKNKYEEEIKERAD
.QIKTLN.KFASF...K..HLEQ...K.LE.KWSLLQQQK.ARSN.D..F.SYI.N.R.....T.G.E.LKL.VE..NM.G.V...FKNK.EEEIKE..D
Retrocopy
KQIKTLNHKFASF\SNKLQHLEQE/EKILESKWSLLQQQKNARSNMDSVFKSYINNPRDSR\HTVGKEELKLKVEHDNMWGPV/GGFKNKNEEEIKEYED


Parental protein
MENEFVLIKKDVDEAYMNKVELESRL-EGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDLDGIISEVKAQYEDIANRSRAEAETMYQIKYE
M.N.FV.I.KD..E...N..ELE....EGLT.EI.FLRQLY.E..R.L..QI.D...VLS.DNSRSLDLDGII.EVK...E...N.S..EA.T.YQIKY.
Retrocopy
MGNKFVFI-KDRNEVDVNMMELECLM\EGLTHEIIFLRQLYGEGLRDLWYQITDMPLVLSIDNSRSLDLDGIIAEVKNHCEEHSNHSWPEAKTLYQIKYK


Parental protein
ELQTLAGKHGDD-LRRTKTEISEMNRSISRLQA
.L..L.GKH.DD.L...K.E.S.MNR.IS..QA
Retrocopy
ALLALTGKHRDD/LLYMKMETS*MNRNIS*HQA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide