RetrogeneDB ID:
retro_mputfur_1272
Organism:
Location:
GL897064.1:3690680-3691455 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.5 %
Coverage:
56.18 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
ODC1
Parental gene aliases:
No gene alias available
Parental gene description:
ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:8109]

Genomic region (view in browser)





>retro_mputfur_1272
GCAAAAGAGCTGCATATTGATATCATCGGTGTCAGCTTCCTTGTAGGAAGTGGTTGTACT
GAGACCTCTGTGCATACTATCCCTGAGACCAGCACTGTCTTTGACATGGGAGCTGAGCTT
GGTTTCAACATGGTACCTGCTTGATATCAAATGTGGCTTTCTTGGATCTGAAGATGTAAA
GCTTAAATTTAAAGAGATCACCAGTGTTATCAACCTAGCACTGGACAAGTGTTTTCCAGC
AGGCTTAGGAGTGAGAATCATAGCTGAGTGCAGCAGATGAGATGTTGCATCAGCTTTCAT
GCTTGTAGTTAATATCATTGCCAAAAAAAATCTTGTACTAAAGGAACAGACAGACTCTGA
TGATGAAGATGAGTTGAACGAACAAACCTTTAGGTATTACATGAATAATGGAGTATATGA
ATCATTTAATTGCATTATTTGTGATCATGCACACATAAAGTCCCTCATGCAGAAGAAACC
CAAACCAGCTTAGAAGTAGTATTCAACCAGCATATGGGTACCAACATGTGACAGCCTTAA
TTGCATTGTTGAGTGTTGTGACTTGCCCTAGATGCATATGGGCGATTGGACGCTCTTTGA
AAACATGGGTGCTTACACTGTTCCTACTGTTTCTACTTTCAAAGGGTTCCAGAGGCCGAC
GATCTACTATGTGACTTCGGAGCCAACATGGCAACCGATGCAGCAGATCCAGAACCATGA
GTTCCTGCTGGAAGGAGAGGAGCAGGATGTCAGCACTCAGCCTATGTCCCATGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ARELNIDIIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNM-YLLDIGGGFPGSEDVKLKFEEITSVINPALDKYFPADSGVSIIAEPGRYYVAS
A.EL.IDIIGVSF.VGSGCT..ET.V..I.....VFDMGAE.GFNM.YLLDI..GF.GSEDVKLKF.EITSVIN.ALDK.FPA..GV.IIAE..R..VAS
Retrocopy
AKELHIDIIGVSFLVGSGCT--ETSVHTIPETSTVFDMGAELGFNM\YLLDIKCGFLGSEDVKLKFKEITSVINLALDKCFPAGLGVRIIAECSR*DVAS


Parental protein
AFTLAVNIIAKK-LVLKEQTGSDDEEESNEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSTSIWGPTCDGLDRIVERCDLPEMHVGDWM
AF.L.VNIIA...LVLKEQT.SDDE.E.NEQTF.YY.N.GVY.SFNCI..DHAH.K.L.QK.PKP..K.YSTSIW.PTCD.L..IVE.CDLP.MH.GDW.
Retrocopy
AFMLVVNIIAXXXLVLKEQTDSDDEDELNEQTFRYYMNNGVYESFNCIICDHAHIKSLMQKKPKPA*K*YSTSIWVPTCDSLNCIVECCDLP*MHMGDWT


Parental protein
VFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQLMQQIQSRDFPAELEEPDASPLPVSCA
.FENMGAYTV...STF.GFQRPTIYYV.S.PTWQ.MQQIQ...F..E.EE.D.S..P.S.A
Retrocopy
LFENMGAYTVPTVSTFKGFQRPTIYYVTSEPTWQPMQQIQNHEFLLEGEEQDVSTQPMSHA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide