RetrogeneDB ID:
retro_mputfur_1274
Organism:
Location:
GL897065.1:1030293-1030616 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.06 %
Coverage:
56.84 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
MRPS23
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein S23 [Source:HGNC Symbol;Acc:14509]

Genomic region (view in browser)





>retro_mputfur_1274
ATGGCGAGGAGCCGGCTGGGGACCCCGGGGAGTGTTTTCTCTCTGACTGGGGACCTGATT
TGCGCTAGGGTGTTGAATGAGAGCCCTTGTGTTTTGACATAGGTAATGCCTTTCCCCCAC
TGAGAGAACCAGTCTTCCAGAGGCCCTGCTTGCAATATGGCAAAGCCCGAGCTGCCACCC
AGGCCGTCTTGTACCCTGAGGATGGGATTAGAGTGAAATTTTATTCAGCCTATGGATCTG
GTCAGAAAGCTTTTGATCTGTTCAATCCAAACTTCAAGTCTACCTGTCAATAGTTTGTGG
AGAAGTACAGAAACTTGGAGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MARSRLETVGSVFSRTRDLIRAGVLNE-KPLWFDVYNAFPPLREPVFRRPRLRYGKAKAAIQDILYPEDRIRAKFYSAYGSGQRAFDLFNPNFKSTCQQF
MARSRL.T.GSVFS.T.DLI.A.VLNE..PL.FD..NAFPPLREPVF.RP.L.YGKA.AA.Q..LYPED.IR.KFYSAYGSGQ.AFDLFNPNFKSTCQ.F
Retrocopy
MARSRLGTPGSVFSLTGDLICARVLNE/EPLCFDIGNAFPPLREPVFQRPCLQYGKARAATQAVLYPEDGIRVKFYSAYGSGQKAFDLFNPNFKSTCQ*F


Parental protein
VEKYIELQK
VEKY..L.K
Retrocopy
VEKYRNLEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide