RetrogeneDB ID:
retro_mputfur_1275
Organism:
Location:
GL897065.1:2673432-2674255 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.8 %
Coverage:
66.51 %
Frameshifts:
6
Stop codons:
2


Parental gene:
Parental gene symbol:
ACTR3
Parental gene aliases:
No gene alias available
Parental gene description:
ARP3 actin-related protein 3 homolog (yeast) [Source:HGNC Symbol;Acc:170]

Genomic region (view in browser)





>retro_mputfur_1275
AAAGGCAATGTGAACCTGGATTTCTTTATTGGGCATGAAGTAATAGGAAAAGCAACACGT
AGCATGAAGTGGCCAACTCAGTATGGTATAGTTGAAGACTGCCACTTGATGGAAAGGTCT
ATGGAACAAGTGTTCTTTAAATACGTAAAGCAGAATTTGAAAGTCATTGCTTTCTGCTGA
TTAAACCTCCACTAAATGCTCCCGAAAACAGAATATATTGTTAAAATAACATTCAAGCCC
TACAAAACTTCAGGCTTATACAAAGCCATGCCGGCTGCTCTTGCATAGGCAGCATCCCGA
GCATCAAAACAAGTAAGAAAATTGATAGTGACTGGTGTGGTGACCAGATAGTGAAGATGG
TACCACTCCTGTCCTTCCTGGAACTGAGGGACCTGTGATCTGCAGCTGTGGAGGGCACAT
TCCAATCACAGGGCAAGTTATAACATATTTCATTCAGCAACTGCTGAGAGGCTGAGAAGT
AGGAATTCCTCTAGAGCAATCCCTGGAAACAGCTATGGAAGTAAAGGAGGGCTGTAATTA
TGTCTGCCCTGATTTAGGAAAAGAATCAGCAAGTATGACACAGGAGAGCCAAGTGGATTA
AACAGTCTACTGGAATCAAGGCAATCTCAAAGAAAGAATTTTCCACTGACGTTGGTTATG
ATGGATCCTTGGGACCTGCATTCTTTTTCATCCAGAATTTGCTAATCCCGACTTCACACA
ACCTACCCAAAAAGTACTGGATGAAGCAATTCAGAATTATCTGATTGGTATCAGGGTTCT
CTCCACAATAATACTGATGTCCCTGAACTGGATGTGGAAGGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLR-AEPEDHYFLLTEPPLNT-PENREYTAEIMFESFNVPGLYIAVQAVLALA
KG...LDFFIG.E.I.K.T...KWP...GIVED..LMER.MEQV.FKY...AE.E.H.FLL..PPLN..P...EY...I.F......GLY.A..A.LA.A
Retrocopy
KGNVNLDFFIGHEVIGKATRSMKWPTQYGIVEDCHLMERSMEQVFFKYVK/AEFESHCFLLIKPPLNA\PKT-EYIVKITFKPYKTSGLYKAMPAALA*A


Parental protein
ASWTSRQVGERTLTGTVI-DSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKE-FNKYDTD
AS..S.QV.....TG.V..DS.DG.T.V.P..EG.VI.SC..HIPI.G..ITYFIQQLLR..EVGIP.EQSLETA..VKE...YVCPDL.KE...KYDT.
Retrocopy
ASRASKQVRKLIVTGVVT\DSEDGTTPVLPGTEGPVICSCGGHIPITGQVITYFIQQLLRG*EVGIPLEQSLETAMEVKEGCNYVCPDLGKE/ISKYDTG


Parental protein
-GSKWIKQYTGINAISKKEFSIDVGYERFLGPEIF-FHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRD
...KWIKQ.TGI.AISKKEFS.DVGY...LGP..F.FHPEFANPDFTQP...V.DE.IQN..I..R......I.L.....M..D
Retrocopy
/RAKWIKQSTGIKAISKKEFSTDVGYDGSLGPAFF/FHPEFANPDFTQPTQKVLDEAIQNYLIGIR--VLSTIILMSLNWMWKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide