RetrogeneDB ID:
retro_mputfur_1276
Organism:
Location:
GL897066.1:509048-509903 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.11 %
Coverage:
71.36 %
Frameshifts:
5
Stop codons:
7


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1276
ATGGGAAAGGAAAAGACTCAAATCACTATCATCATCATTGGACATGTAGTTTAAGGCAAG
TCTACCTCTACTGGTCATCTGATATAGAAATGAGGTGAGATTGACAAAAGAACCATCAAA
AATTTGAGAAGGAGGCTGCTGAGATGGGAAAGGGATCCAAGTATACCTGGGTCTTGGATA
AACTGAAAACTGAATGTAAATATGATATCACCTCTGATATCTCCCTGTAAAAATTCAAGA
CCAGCAAGTATTATGTGACTATCATTGATGCCCCCAAGACACAGAGACTTTATCAAAAAC
ATGATTCTTAGGCACATCTGAGGCATATCTCAGGCTGACTGTACTGTCCTGATTGCTGCT
GCTGTGTTGATGAATTTGAAGCATGTATCTCCAAGAATGGGCAGACCCATGAGCATCCCC
TTCTGGCTTACACACTGGGTATAAAATAACTAATTGCTGGTGTTAACAACATGGATTCCA
CTGAGCCACCCTACAGCCAGAAGAGATATGAGGAAATCGTAAAGGAAGTCAGCACCTACA
TTAAGAAAATTGGCTACAACCCAATGCAGTAGGATTTGTGCCCATTTCTGGTTGGAATGG
TGACAGCATGCTGGAGCAAAATGCTAACATACCTTGGTTCAAGGGATGGAAAGTCACCTA
AAAGGTGGGAATGCCAGTGGAACCATACCACTTGAAGCTCTGGATTGCATTTTGCCACCA
GCTCATCCAACTGACAAGCCCTTGTATCTGCCTCTCCAGAACATCTACAAAATTGGTATT
TGTACTGTCCCTGTGGGCTGAGCAGAGACTGGTGTTCTTAAACCTGCCACAGTCGTCATC
TTTGCTACAATGTCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTI-EKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPG-HRDF
MGKEKT.I.I..IGHV..GKST.TGHLI.K.G.IDKRTI..KFEKEAAEMGKGS.KY.WVLDKLK.E....IT.DISL.KF.TSKYYVTIIDAP..HRDF
Retrocopy
MGKEKTQITIIIIGHVV*GKSTSTGHLI*K*GEIDKRTI/QKFEKEAAEMGKGS-KYTWVLDKLKTECKYDITSDISL*KFKTSKYYVTIIDAPK\HRDF


Parental protein
IKNMIT----GTSQADCAVLIVAAG-VGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNP-DTVAFVP
IKNMI.....G.SQADC.VLI.AA..V.EFEA.ISKNGQT.EH.LLAYTLG.K.LI.GVN.MDSTEPPYSQKRYEEIVKEVSTYIKKIGYNP...V.FVP
Retrocopy
IKNMILRHI*GISQADCTVLIAAAV/VDEFEACISKNGQTHEHPLLAYTLGIK*LIAGVNNMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNP/NAVGFVP


Parental protein
ISGWNGDNMLEPSANMPWFKGWKVT-RKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVN
ISGWNGD.MLE..AN.PWFKGWKVT..K.GNASGT..LEALDCILPP..PTDKPL.LPLQ..YKI.GI.TVPVG..ETGVLKP..VV.FA...
Retrocopy
ISGWNGDSMLEQNANIPWFKGWKVT/LKGGNASGTIPLEALDCILPPAHPTDKPLYLPLQNIYKI-GICTVPVG*AETGVLKPATVVIFATMS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide