RetrogeneDB ID:
retro_mputfur_1282
Organism:
Location:
GL897067.1:972785-973090 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.12 %
Coverage:
90.35 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
PPDPF
Parental gene aliases:
No gene alias available
Parental gene description:
pancreatic progenitor cell differentiation and proliferation factor homolog (zebrafish) [Source:HGNC Symbol;Acc:16142]

Genomic region (view in browser)





>retro_mputfur_1282
GCAGCCGTCCCCTCCAGTGGTGCACCCATGGCCACCCACGACTACTACCAGTGCCGCCTG
GGCTCCATGGCCAGTAACAGCTCCTGCAAAAGTGCAGAGTATGCTGGTGAAACCATCCCT
CACCACTTGGGTCTCCCCAAGGCTGACCTAGGTCACTGGTGGGCAAACTTCTTTGGGAAG
TCCACTCTCCCAATCAGGGCTACAGTGTCGGAGTCCCCAGAATGCTCAGAGTCTCCTCAG
GCTCCAGTGGCAAGATCACCTGTGACTTGGTTCTAGAAGCCGTGAGGAAGCAGCCTGGTG
GCCGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAIPSSGSLVATHDYYRRRLGSTSSSSSCGSAECAGEAIPHPPGLPKADPGHWWASFFFGKSTVPFMATVLESPERSEPPQA-SSGTITSDPAPEAVRKQ
AA.PSSG...ATHDYY..RLGS..S.SSC.SAE.AGE.IPH..GLPKAD.GHWWA..FFGKST.P..ATV.ESPE.SE.PQA.SSG.IT.D...EAVRKQ
Retrocopy
AAVPSSGAPMATHDYYQCRLGSMASNSSCKSAEYAGETIPHHLGLPKADLGHWWAN-FFGKSTLPIRATVSESPECSESPQA/SSGKITCDLVLEAVRKQ


Parental protein
PGGR
PGGR
Retrocopy
PGGR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide