RetrogeneDB ID:
retro_mputfur_1283
Organism:
Location:
GL897067.1:2988318-2988808 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.5 %
Coverage:
85.49 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1283
GCTCAAAGGACACAAAGGTGCAGCTATCTTCCGTTGTCCCGAATCTAGGTTCATCTGACA
CCAGCCACCTCTACTACCATGTGGCCTAAGTTCAACCACAAAGAGATCAAAGTTGTGTGC
CTGAGATGCATCTGTGGGAAATTTGGTGCCACATCTGCTCTCACCCCAAAGATTAGCTGA
TGGGGTCTGTCTCCAAAAATGGTTGGTAATGAAATGGCCAAGGCAACCGGTAAGTGGAAG
GGTCTGAGATTAGAATGAAACTGACCAGTCAGAACAGACAGGCGCAGATCAGAGTGGTAC
CTTCTGCCTTTGCCTGATTGCCACAGCCCTCAAGGAATGGCCAAGAGACAGAAAGAAGAA
GGATAACATTAAGCCCAGTGGAATTACCACTTTTGATGAGACTGTTGACATTGCCCAACA
GATGTGGAACTGATCTGTAGCCAGAGAACTCTCTGGAACCATTAAGGAGATCCTCGGGAC
TGCTCAATCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ARRRQRCNSLRSSRIRVHPTPATSA-MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLR-ITVKLTIQNRQAQIEV
A.R.QRC..L..SRI.VH.TPATS..M.PKF...EIKVV.LRC..................GLSPK.VG...AKATG.WKGLR.I..KLT.QNRQAQI.V
Retrocopy
AQRTQRCSYLPLSRI*VHLTPATSTTMWPKFNHKEIKVVCLRCXXXXXXXXXXXXXXXXXWGLSPKMVGNEMAKATGKWKGLR/IRMKLTSQNRQAQIRV


Parental protein
VPSASA-LIIKALKEPPRDRKKQKNSAVKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQS
VPSA.A.LI..ALKE.PRDRKK..N...K.SG..TFDE.V.IA.QM...S.ARELSGTIKEILGTAQS
Retrocopy
VPSAFA/LIATALKEWPRDRKKKDN--IKPSGITTFDETVDIAQQMWN*SVARELSGTIKEILGTAQS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide